Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B8G2

Protein Details
Accession A0A1S8B8G2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-177HGRGGHTRPPHRRTVNRRPPWSLABasic
NLS Segment(s)
PositionSequence
158-187GHTRPPHRRTVNRRPPWSLATARFKAFRRK
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001830  Glyco_trans_20  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0005992  P:trehalose biosynthetic process  
Pfam View protein in Pfam  
PF00982  Glyco_transf_20  
Amino Acid Sequences MRSSSRSTTLLPYGWTILWPVFHYQIPDHPKSKAYEDHSWIYYEHVNQAFADKIVKSYKRGDIIWIHDYHLLLAPGMVRKKSLSDIRIRIKVLHNFSRMRRFQPYSAVVEAVKASEVLELTEDEEVRRKVPLDEKFGNSYDDTNLDPFIFKNTHGRGGHTRPPHRRTVNRRPPWSLATARFKAFRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.18
4 0.15
5 0.15
6 0.15
7 0.17
8 0.17
9 0.18
10 0.2
11 0.2
12 0.27
13 0.33
14 0.37
15 0.36
16 0.35
17 0.38
18 0.39
19 0.42
20 0.42
21 0.41
22 0.43
23 0.46
24 0.48
25 0.46
26 0.44
27 0.39
28 0.34
29 0.3
30 0.23
31 0.23
32 0.2
33 0.2
34 0.18
35 0.2
36 0.18
37 0.15
38 0.16
39 0.11
40 0.13
41 0.19
42 0.21
43 0.22
44 0.26
45 0.31
46 0.32
47 0.33
48 0.34
49 0.32
50 0.36
51 0.37
52 0.33
53 0.3
54 0.28
55 0.27
56 0.23
57 0.2
58 0.15
59 0.1
60 0.09
61 0.09
62 0.11
63 0.12
64 0.12
65 0.11
66 0.11
67 0.12
68 0.17
69 0.21
70 0.21
71 0.27
72 0.34
73 0.39
74 0.43
75 0.42
76 0.4
77 0.4
78 0.42
79 0.4
80 0.39
81 0.38
82 0.38
83 0.4
84 0.47
85 0.43
86 0.41
87 0.42
88 0.4
89 0.37
90 0.4
91 0.4
92 0.34
93 0.33
94 0.3
95 0.24
96 0.21
97 0.2
98 0.13
99 0.1
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.11
112 0.12
113 0.11
114 0.12
115 0.13
116 0.15
117 0.23
118 0.28
119 0.32
120 0.36
121 0.39
122 0.42
123 0.42
124 0.41
125 0.34
126 0.29
127 0.22
128 0.19
129 0.17
130 0.14
131 0.14
132 0.12
133 0.12
134 0.11
135 0.14
136 0.13
137 0.13
138 0.21
139 0.23
140 0.32
141 0.32
142 0.37
143 0.4
144 0.47
145 0.54
146 0.55
147 0.62
148 0.63
149 0.68
150 0.73
151 0.74
152 0.77
153 0.79
154 0.81
155 0.83
156 0.83
157 0.86
158 0.83
159 0.79
160 0.73
161 0.7
162 0.66
163 0.64
164 0.63
165 0.6
166 0.57
167 0.58