Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2DYB1

Protein Details
Accession A0A0G2DYB1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MANKIEKASRQQRKQRKNRSKEFRGTAKSKHydrophilic
NLS Segment(s)
PositionSequence
102-133EKASRQQRKQRKNRSKEFRGTAKSKGGKKDKK
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNPLLGRKQMVVDVLHPNRPNVSKDELREKLAQLYKASKDQVNCFGFRTQYGGGKSTGFALIYDSNESMKKFEPHYRLVRVGMANKIEKASRQQRKQRKNRSKEFRGTAKSKGGKKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.3
25 0.34
26 0.42
27 0.41
28 0.42
29 0.42
30 0.39
31 0.39
32 0.38
33 0.37
34 0.3
35 0.32
36 0.3
37 0.31
38 0.33
39 0.27
40 0.26
41 0.27
42 0.33
43 0.31
44 0.29
45 0.27
46 0.27
47 0.25
48 0.23
49 0.23
50 0.15
51 0.17
52 0.17
53 0.17
54 0.16
55 0.16
56 0.16
57 0.13
58 0.13
59 0.09
60 0.07
61 0.08
62 0.09
63 0.09
64 0.1
65 0.09
66 0.1
67 0.11
68 0.12
69 0.11
70 0.13
71 0.14
72 0.17
73 0.24
74 0.28
75 0.33
76 0.39
77 0.42
78 0.42
79 0.41
80 0.41
81 0.37
82 0.35
83 0.32
84 0.3
85 0.28
86 0.26
87 0.27
88 0.23
89 0.22
90 0.28
91 0.35
92 0.41
93 0.5
94 0.59
95 0.68
96 0.79
97 0.88
98 0.9
99 0.91
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.75
110 0.74
111 0.72
112 0.68
113 0.7