Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8BAM7

Protein Details
Accession A0A1S8BAM7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-94FDSGRDRPRRRDASPRRGRSVBasic
NLS Segment(s)
PositionSequence
78-100RDRPRRRDASPRRGRSVSPPRRG
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MSGRGGTTLYVTGFGHGTRARDLAYEFERFAFVEYESRRDADDAYHEMHNKRIGRDDLLKIEWARTPPSASWRFDSGRDRPRRRDASPRRGRSVSPPRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.16
5 0.16
6 0.17
7 0.16
8 0.16
9 0.17
10 0.18
11 0.19
12 0.19
13 0.18
14 0.18
15 0.18
16 0.17
17 0.17
18 0.13
19 0.11
20 0.15
21 0.15
22 0.18
23 0.19
24 0.19
25 0.18
26 0.17
27 0.17
28 0.12
29 0.14
30 0.13
31 0.14
32 0.16
33 0.17
34 0.17
35 0.19
36 0.23
37 0.21
38 0.2
39 0.22
40 0.22
41 0.23
42 0.28
43 0.28
44 0.26
45 0.26
46 0.27
47 0.23
48 0.23
49 0.21
50 0.18
51 0.18
52 0.16
53 0.17
54 0.16
55 0.25
56 0.29
57 0.29
58 0.31
59 0.33
60 0.34
61 0.37
62 0.42
63 0.42
64 0.47
65 0.56
66 0.6
67 0.63
68 0.72
69 0.74
70 0.73
71 0.76
72 0.77
73 0.77
74 0.81
75 0.81
76 0.79
77 0.74
78 0.71
79 0.71
80 0.71