Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B4R1

Protein Details
Accession A0A1S8B4R1   
Localization Confidence High
Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKPLSFKGDEKPRKRKRAAADDNEDGHydrophilic
194-220TFRIRMQARFKPRPKTNKEQRAAEKISHydrophilic
234-253DDEVKKLKRSRRDGNFHETLBasic
NLS Segment(s)
PositionSequence
11-18EKPRKRKR
204-216KPRPKTNKEQRAA
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLSFKGDEKPRKRKRAAADDNEDGAPAGKELSKAGSSAAPAAEDDDSWVTAEAASDISGPVTFVLPTDPASFLGCDANGTVFTSKVENMVEDDALTAEPHDVRQVWIAHRVAGSETFSFKGHHGKYLACDKFGVLSAQREAVSQDESFLCIPVADNPGTFAVQTQREKFIAVDEGKNEVRGDSENIDFNSTFRIRMQARFKPRPKTNKEQRAAEKISRKELEEMVGRPLEDDEVKKLKRSRRDGNFHETLLDVKVKGKHDKFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.85
4 0.84
5 0.85
6 0.86
7 0.85
8 0.82
9 0.76
10 0.73
11 0.64
12 0.54
13 0.42
14 0.32
15 0.22
16 0.14
17 0.1
18 0.08
19 0.09
20 0.1
21 0.13
22 0.13
23 0.13
24 0.14
25 0.14
26 0.14
27 0.15
28 0.14
29 0.11
30 0.11
31 0.12
32 0.11
33 0.09
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.1
58 0.1
59 0.11
60 0.12
61 0.12
62 0.11
63 0.12
64 0.1
65 0.08
66 0.08
67 0.08
68 0.07
69 0.08
70 0.08
71 0.07
72 0.08
73 0.09
74 0.08
75 0.09
76 0.09
77 0.08
78 0.1
79 0.1
80 0.1
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.07
93 0.11
94 0.13
95 0.13
96 0.19
97 0.19
98 0.19
99 0.19
100 0.19
101 0.16
102 0.14
103 0.15
104 0.09
105 0.1
106 0.1
107 0.11
108 0.12
109 0.12
110 0.19
111 0.17
112 0.2
113 0.2
114 0.2
115 0.22
116 0.31
117 0.3
118 0.23
119 0.23
120 0.19
121 0.19
122 0.19
123 0.17
124 0.08
125 0.09
126 0.09
127 0.11
128 0.11
129 0.1
130 0.1
131 0.1
132 0.11
133 0.09
134 0.1
135 0.08
136 0.1
137 0.09
138 0.09
139 0.08
140 0.06
141 0.06
142 0.07
143 0.1
144 0.09
145 0.09
146 0.1
147 0.11
148 0.11
149 0.1
150 0.09
151 0.1
152 0.16
153 0.19
154 0.2
155 0.23
156 0.23
157 0.24
158 0.23
159 0.2
160 0.21
161 0.2
162 0.2
163 0.18
164 0.22
165 0.22
166 0.23
167 0.21
168 0.15
169 0.14
170 0.13
171 0.15
172 0.13
173 0.14
174 0.16
175 0.16
176 0.19
177 0.18
178 0.16
179 0.2
180 0.18
181 0.17
182 0.15
183 0.22
184 0.21
185 0.29
186 0.38
187 0.4
188 0.5
189 0.6
190 0.66
191 0.7
192 0.77
193 0.8
194 0.8
195 0.83
196 0.84
197 0.84
198 0.84
199 0.83
200 0.82
201 0.8
202 0.78
203 0.75
204 0.72
205 0.65
206 0.67
207 0.6
208 0.54
209 0.48
210 0.44
211 0.41
212 0.37
213 0.34
214 0.3
215 0.29
216 0.27
217 0.24
218 0.23
219 0.21
220 0.18
221 0.19
222 0.21
223 0.28
224 0.29
225 0.36
226 0.42
227 0.47
228 0.55
229 0.62
230 0.66
231 0.68
232 0.78
233 0.78
234 0.8
235 0.78
236 0.68
237 0.6
238 0.5
239 0.41
240 0.34
241 0.29
242 0.2
243 0.2
244 0.26
245 0.3
246 0.39