Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B4S0

Protein Details
Accession A0A1S8B4S0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-41PPCPRELHLRVWRNHDKRKASFNWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 7.5, extr 7, nucl 4, cysk 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001547  Glyco_hydro_5  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0000272  P:polysaccharide catabolic process  
Pfam View protein in Pfam  
PF00150  Cellulase  
Amino Acid Sequences MICSSSFGASTFLDLNIPPCPRELHLRVWRNHDKRKASFNWGSDKVRGVNIGGWLVLEPWITPSIFEQFDASQGIVDEFTLSEKLGAAKAGEILKPHWDSWVGYEDFQRIADAGMNVVRIPIGFWAYDTFGSSYAKGAAPYMDAALDWARGTGLKVIIDLHGAPGSQNGYDNSGQRMDSPQWTQGDTVDQTLSVLNTIAEKYGTAEYEDVVAGIQLLNEPAGYTLDLNTIKQFDRDGYGKVRAVGETPVVVHDAFQSPASYNGFMTASDNDVRNVAIDHHEYQVFDTGMIAWSAQEHRQGVCNNKARWEGADKWTFVGEWTGAMTDCAKWLNGYGRGARYDGSFEGSSYVGDCAFASDLSSWDQQRKDDTRWYIETQLEAFEKVDGWVFWNFKTEAAPEWDWSKLSDAGVFPNPVTDRKFSAIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.19
4 0.2
5 0.18
6 0.19
7 0.21
8 0.22
9 0.32
10 0.34
11 0.39
12 0.48
13 0.56
14 0.6
15 0.67
16 0.76
17 0.75
18 0.81
19 0.8
20 0.79
21 0.76
22 0.81
23 0.77
24 0.76
25 0.74
26 0.7
27 0.7
28 0.67
29 0.65
30 0.57
31 0.55
32 0.48
33 0.42
34 0.38
35 0.3
36 0.26
37 0.24
38 0.22
39 0.17
40 0.15
41 0.13
42 0.12
43 0.12
44 0.09
45 0.07
46 0.08
47 0.1
48 0.1
49 0.1
50 0.11
51 0.16
52 0.16
53 0.16
54 0.16
55 0.15
56 0.17
57 0.18
58 0.16
59 0.11
60 0.11
61 0.11
62 0.09
63 0.08
64 0.07
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.12
77 0.14
78 0.14
79 0.14
80 0.15
81 0.21
82 0.23
83 0.23
84 0.21
85 0.2
86 0.2
87 0.22
88 0.28
89 0.23
90 0.22
91 0.23
92 0.23
93 0.22
94 0.22
95 0.19
96 0.11
97 0.1
98 0.11
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.08
113 0.1
114 0.1
115 0.11
116 0.11
117 0.11
118 0.12
119 0.11
120 0.11
121 0.11
122 0.12
123 0.11
124 0.11
125 0.09
126 0.09
127 0.09
128 0.09
129 0.07
130 0.06
131 0.07
132 0.07
133 0.07
134 0.06
135 0.05
136 0.05
137 0.05
138 0.06
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.06
151 0.07
152 0.08
153 0.07
154 0.08
155 0.08
156 0.11
157 0.13
158 0.14
159 0.15
160 0.15
161 0.15
162 0.15
163 0.18
164 0.16
165 0.17
166 0.18
167 0.2
168 0.2
169 0.21
170 0.2
171 0.18
172 0.19
173 0.16
174 0.15
175 0.11
176 0.1
177 0.09
178 0.09
179 0.09
180 0.06
181 0.05
182 0.04
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.06
197 0.05
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.04
211 0.04
212 0.08
213 0.08
214 0.09
215 0.09
216 0.11
217 0.11
218 0.11
219 0.11
220 0.08
221 0.12
222 0.13
223 0.15
224 0.16
225 0.2
226 0.2
227 0.21
228 0.21
229 0.17
230 0.17
231 0.15
232 0.12
233 0.09
234 0.09
235 0.08
236 0.08
237 0.08
238 0.07
239 0.07
240 0.08
241 0.08
242 0.09
243 0.09
244 0.08
245 0.11
246 0.12
247 0.11
248 0.1
249 0.11
250 0.1
251 0.1
252 0.11
253 0.09
254 0.11
255 0.12
256 0.13
257 0.12
258 0.12
259 0.11
260 0.1
261 0.1
262 0.09
263 0.1
264 0.12
265 0.13
266 0.15
267 0.16
268 0.16
269 0.16
270 0.18
271 0.15
272 0.12
273 0.11
274 0.09
275 0.09
276 0.09
277 0.08
278 0.05
279 0.06
280 0.08
281 0.09
282 0.12
283 0.13
284 0.14
285 0.19
286 0.23
287 0.28
288 0.35
289 0.42
290 0.4
291 0.44
292 0.46
293 0.41
294 0.41
295 0.41
296 0.37
297 0.36
298 0.4
299 0.36
300 0.34
301 0.34
302 0.31
303 0.25
304 0.21
305 0.13
306 0.09
307 0.09
308 0.08
309 0.08
310 0.08
311 0.09
312 0.07
313 0.08
314 0.09
315 0.08
316 0.08
317 0.11
318 0.16
319 0.19
320 0.23
321 0.26
322 0.28
323 0.29
324 0.3
325 0.28
326 0.23
327 0.22
328 0.19
329 0.2
330 0.17
331 0.16
332 0.17
333 0.16
334 0.15
335 0.13
336 0.13
337 0.08
338 0.08
339 0.08
340 0.07
341 0.08
342 0.08
343 0.08
344 0.08
345 0.09
346 0.13
347 0.17
348 0.18
349 0.23
350 0.25
351 0.26
352 0.34
353 0.38
354 0.4
355 0.45
356 0.49
357 0.5
358 0.53
359 0.55
360 0.52
361 0.48
362 0.45
363 0.37
364 0.35
365 0.29
366 0.25
367 0.21
368 0.16
369 0.15
370 0.13
371 0.15
372 0.1
373 0.12
374 0.17
375 0.18
376 0.18
377 0.23
378 0.22
379 0.21
380 0.24
381 0.22
382 0.21
383 0.27
384 0.28
385 0.25
386 0.27
387 0.28
388 0.26
389 0.26
390 0.26
391 0.21
392 0.2
393 0.21
394 0.2
395 0.24
396 0.28
397 0.28
398 0.24
399 0.27
400 0.29
401 0.29
402 0.32
403 0.31
404 0.31