Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8B9Z3

Protein Details
Accession A0A1S8B9Z3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-47GQLRTTGKKLFRKKYYRHTTRPGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005823  Ribosomal_L13_bac-type  
IPR023563  Ribosomal_L13_CS  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
PROSITE View protein in PROSITE  
PS00783  RIBOSOMAL_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MGKHKPIFDPSTDCGDYVVATNCGQLRTTGKKLFRKKYYRHTTRPGSLQEITMQRLMEKWGGGEILSRAVSGMLPKNRLRKVRLARLKAFEGAAHPYKKNILKVAGQEASSIRELPEVKKAFAGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.24
4 0.2
5 0.19
6 0.13
7 0.12
8 0.15
9 0.15
10 0.16
11 0.16
12 0.15
13 0.19
14 0.24
15 0.31
16 0.35
17 0.42
18 0.51
19 0.6
20 0.68
21 0.72
22 0.75
23 0.76
24 0.8
25 0.84
26 0.84
27 0.83
28 0.82
29 0.79
30 0.75
31 0.73
32 0.65
33 0.59
34 0.5
35 0.42
36 0.38
37 0.32
38 0.29
39 0.24
40 0.21
41 0.16
42 0.15
43 0.16
44 0.12
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.13
60 0.13
61 0.18
62 0.22
63 0.29
64 0.35
65 0.4
66 0.42
67 0.46
68 0.52
69 0.59
70 0.65
71 0.65
72 0.65
73 0.65
74 0.64
75 0.55
76 0.47
77 0.37
78 0.29
79 0.28
80 0.28
81 0.27
82 0.25
83 0.24
84 0.31
85 0.34
86 0.36
87 0.34
88 0.33
89 0.33
90 0.37
91 0.44
92 0.4
93 0.36
94 0.33
95 0.3
96 0.29
97 0.26
98 0.22
99 0.15
100 0.17
101 0.19
102 0.2
103 0.28
104 0.28
105 0.28
106 0.3