Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B3C7

Protein Details
Accession A0A1S8B3C7   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-66LPRRRFSPGRSPPPARRPPPBasic
126-152DYSYRPRSYSRSRSPRRSRSRSYSSRSHydrophilic
NLS Segment(s)
PositionSequence
49-202RRRFSPGRSPPPARRPPPPSYNDRFEGPPPRAPPPGGNYSRGPPPGGPYPGGPSGRYRSPPMNRRGYGGAGRGGGRGDYSYRPRSYSRSRSPRRSRSRSYSSRSPSRTPPPRRGGGGGGGGGGIRGGGGSYRDSPPPPRGGGGGSGSGGRRRRS
215-226SRSRSRGGRDRR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.833, mito 3.5, cyto_mito 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MPINRQFMTNRGTAYIMFADPAAAEAAIAHMHEAQLDGAVLTVSIVLPRRRFSPGRSPPPARRPPPPSYNDRFEGPPPRAPPPGGNYSRGPPPGGPYPGGPSGRYRSPPMNRRGYGGAGRGGGRGDYSYRPRSYSRSRSPRRSRSRSYSSRSPSRTPPPRRGGGGGGGGGGIRGGGGSYRDSPPPPRGGGGGSGSGGRRRRSPSYSSYSSYSERSRSRSRGGRDRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.17
4 0.15
5 0.13
6 0.12
7 0.1
8 0.11
9 0.08
10 0.06
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.03
31 0.05
32 0.1
33 0.14
34 0.16
35 0.18
36 0.21
37 0.27
38 0.3
39 0.34
40 0.41
41 0.48
42 0.55
43 0.62
44 0.67
45 0.7
46 0.78
47 0.82
48 0.74
49 0.73
50 0.7
51 0.69
52 0.71
53 0.68
54 0.66
55 0.63
56 0.64
57 0.58
58 0.53
59 0.47
60 0.43
61 0.45
62 0.4
63 0.39
64 0.36
65 0.37
66 0.37
67 0.36
68 0.34
69 0.32
70 0.38
71 0.35
72 0.35
73 0.33
74 0.33
75 0.37
76 0.34
77 0.3
78 0.21
79 0.23
80 0.24
81 0.24
82 0.23
83 0.19
84 0.21
85 0.25
86 0.26
87 0.22
88 0.2
89 0.22
90 0.24
91 0.26
92 0.25
93 0.28
94 0.35
95 0.42
96 0.47
97 0.52
98 0.49
99 0.5
100 0.48
101 0.43
102 0.37
103 0.31
104 0.25
105 0.17
106 0.17
107 0.15
108 0.13
109 0.11
110 0.09
111 0.08
112 0.08
113 0.11
114 0.16
115 0.21
116 0.22
117 0.25
118 0.26
119 0.32
120 0.4
121 0.46
122 0.51
123 0.57
124 0.64
125 0.73
126 0.82
127 0.86
128 0.88
129 0.86
130 0.84
131 0.82
132 0.84
133 0.81
134 0.79
135 0.77
136 0.74
137 0.75
138 0.72
139 0.67
140 0.64
141 0.66
142 0.69
143 0.67
144 0.69
145 0.68
146 0.67
147 0.65
148 0.6
149 0.52
150 0.45
151 0.4
152 0.3
153 0.22
154 0.18
155 0.15
156 0.12
157 0.09
158 0.05
159 0.03
160 0.02
161 0.02
162 0.03
163 0.04
164 0.07
165 0.1
166 0.13
167 0.16
168 0.18
169 0.23
170 0.28
171 0.31
172 0.31
173 0.29
174 0.28
175 0.27
176 0.28
177 0.26
178 0.22
179 0.18
180 0.18
181 0.18
182 0.24
183 0.27
184 0.26
185 0.3
186 0.35
187 0.41
188 0.45
189 0.5
190 0.52
191 0.56
192 0.59
193 0.57
194 0.55
195 0.52
196 0.49
197 0.48
198 0.45
199 0.44
200 0.43
201 0.47
202 0.52
203 0.54
204 0.6
205 0.64
206 0.69