Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B5C5

Protein Details
Accession A0A1S8B5C5   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MEGRLKKKADRERRRKREREELAAAIBasic
NLS Segment(s)
PositionSequence
4-19RLKKKADRERRRKRER
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
Amino Acid Sequences MEGRLKKKADRERRRKREREELAAAIAEAPPVTFVEPAKIKPRISLYVRVALAADAQQIAGIYNHYVQNSIKSAEVVPLSVPDLARRIADETGSSMPWLVACQKGKKSGRGYTNGTDALILGFACASDYLSRQSMYAYTAEAEVFVHPNYHRHMIGSCLMDRLLYILDTCYDAKRGYQFTATGPFAEHGGARVIGSVIMNVPFDKKDPEDLEGIAKFLGKFNFKKEAELPNIGVKKHMHVSLATFRYYTGTIINPKEAFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.92
4 0.92
5 0.9
6 0.88
7 0.83
8 0.75
9 0.66
10 0.56
11 0.47
12 0.37
13 0.28
14 0.18
15 0.11
16 0.08
17 0.06
18 0.06
19 0.07
20 0.08
21 0.08
22 0.15
23 0.17
24 0.21
25 0.28
26 0.33
27 0.33
28 0.36
29 0.41
30 0.42
31 0.44
32 0.5
33 0.46
34 0.48
35 0.48
36 0.44
37 0.38
38 0.3
39 0.27
40 0.18
41 0.15
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.09
51 0.11
52 0.11
53 0.12
54 0.12
55 0.16
56 0.17
57 0.17
58 0.15
59 0.14
60 0.15
61 0.16
62 0.16
63 0.12
64 0.1
65 0.1
66 0.11
67 0.11
68 0.1
69 0.09
70 0.1
71 0.1
72 0.1
73 0.1
74 0.12
75 0.11
76 0.11
77 0.1
78 0.11
79 0.12
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.09
86 0.08
87 0.11
88 0.14
89 0.19
90 0.21
91 0.3
92 0.33
93 0.39
94 0.44
95 0.45
96 0.48
97 0.5
98 0.52
99 0.45
100 0.46
101 0.39
102 0.33
103 0.26
104 0.2
105 0.14
106 0.1
107 0.07
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.06
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.1
136 0.12
137 0.15
138 0.14
139 0.14
140 0.15
141 0.16
142 0.19
143 0.19
144 0.17
145 0.15
146 0.15
147 0.14
148 0.13
149 0.11
150 0.08
151 0.05
152 0.05
153 0.05
154 0.05
155 0.07
156 0.08
157 0.08
158 0.1
159 0.1
160 0.11
161 0.15
162 0.17
163 0.17
164 0.18
165 0.18
166 0.19
167 0.24
168 0.23
169 0.19
170 0.18
171 0.17
172 0.15
173 0.15
174 0.13
175 0.08
176 0.09
177 0.08
178 0.08
179 0.08
180 0.07
181 0.07
182 0.07
183 0.07
184 0.06
185 0.07
186 0.07
187 0.07
188 0.09
189 0.09
190 0.1
191 0.13
192 0.14
193 0.2
194 0.22
195 0.24
196 0.24
197 0.24
198 0.28
199 0.25
200 0.24
201 0.17
202 0.16
203 0.14
204 0.16
205 0.19
206 0.21
207 0.23
208 0.28
209 0.37
210 0.36
211 0.41
212 0.43
213 0.48
214 0.48
215 0.5
216 0.47
217 0.46
218 0.48
219 0.44
220 0.42
221 0.35
222 0.33
223 0.34
224 0.34
225 0.27
226 0.25
227 0.31
228 0.36
229 0.38
230 0.34
231 0.29
232 0.27
233 0.29
234 0.28
235 0.23
236 0.16
237 0.19
238 0.25
239 0.29
240 0.35