Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B8A7

Protein Details
Accession A0A1S8B8A7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
139-174SSGVVRWHCWRRRRRRARRRRRRRRRFVGSWRRGWLBasic
NLS Segment(s)
PositionSequence
149-168RRRRRRARRRRRRRRRFVGS
Subcellular Location(s) plas 17, mito 4, E.R. 2, golg 2, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSEPQKFEWLIILPDQDGALPRRMEVRQQHLSNLQTYPPDFWLWGGGFLEDVPKEGEPMKMLGSAMLAWAASKEEVLEKLKKDVYTENQVWDWNKVCVCVCFPPFFCFFFFVDLSLSRSLFLRLRYGSGFWFWGREVSSGVVRWHCWRRRRRRARRRRRRRRRFVGSWRRGWLAGWLGGLMLDERRRAARDSHLILFLSFFPFFFFFGRLCIPWHLHSIYTLLPGRRSIEHEHERNKINAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.15
5 0.16
6 0.16
7 0.2
8 0.18
9 0.19
10 0.24
11 0.25
12 0.32
13 0.36
14 0.42
15 0.46
16 0.48
17 0.51
18 0.51
19 0.53
20 0.48
21 0.42
22 0.35
23 0.29
24 0.29
25 0.26
26 0.23
27 0.21
28 0.18
29 0.17
30 0.19
31 0.16
32 0.17
33 0.15
34 0.12
35 0.11
36 0.11
37 0.14
38 0.09
39 0.1
40 0.1
41 0.09
42 0.1
43 0.11
44 0.12
45 0.11
46 0.12
47 0.12
48 0.11
49 0.11
50 0.1
51 0.1
52 0.09
53 0.07
54 0.07
55 0.05
56 0.04
57 0.04
58 0.05
59 0.05
60 0.04
61 0.05
62 0.06
63 0.09
64 0.13
65 0.17
66 0.17
67 0.21
68 0.24
69 0.24
70 0.25
71 0.27
72 0.29
73 0.33
74 0.34
75 0.32
76 0.3
77 0.32
78 0.31
79 0.29
80 0.25
81 0.19
82 0.17
83 0.16
84 0.16
85 0.14
86 0.15
87 0.17
88 0.17
89 0.18
90 0.19
91 0.21
92 0.22
93 0.22
94 0.21
95 0.19
96 0.18
97 0.18
98 0.17
99 0.14
100 0.13
101 0.13
102 0.14
103 0.12
104 0.12
105 0.09
106 0.09
107 0.1
108 0.11
109 0.12
110 0.13
111 0.12
112 0.14
113 0.14
114 0.15
115 0.14
116 0.13
117 0.14
118 0.1
119 0.11
120 0.09
121 0.1
122 0.11
123 0.11
124 0.11
125 0.1
126 0.11
127 0.12
128 0.13
129 0.13
130 0.13
131 0.18
132 0.26
133 0.32
134 0.39
135 0.48
136 0.58
137 0.69
138 0.79
139 0.85
140 0.88
141 0.93
142 0.96
143 0.97
144 0.97
145 0.97
146 0.97
147 0.97
148 0.97
149 0.97
150 0.96
151 0.95
152 0.95
153 0.95
154 0.92
155 0.87
156 0.79
157 0.7
158 0.6
159 0.49
160 0.41
161 0.33
162 0.25
163 0.19
164 0.15
165 0.13
166 0.13
167 0.12
168 0.09
169 0.08
170 0.08
171 0.09
172 0.1
173 0.13
174 0.15
175 0.17
176 0.19
177 0.25
178 0.31
179 0.36
180 0.37
181 0.37
182 0.36
183 0.34
184 0.32
185 0.25
186 0.2
187 0.15
188 0.12
189 0.12
190 0.13
191 0.14
192 0.14
193 0.14
194 0.11
195 0.14
196 0.17
197 0.16
198 0.18
199 0.21
200 0.23
201 0.24
202 0.29
203 0.27
204 0.25
205 0.25
206 0.25
207 0.22
208 0.25
209 0.27
210 0.24
211 0.25
212 0.27
213 0.29
214 0.29
215 0.33
216 0.34
217 0.39
218 0.47
219 0.54
220 0.58
221 0.62
222 0.64