Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B3R8

Protein Details
Accession A0A1S8B3R8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
355-374RTGVAKQRKVVKRMRWAYAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013946  NCA2  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF08637  NCA2  
Amino Acid Sequences MDIVLQEVADPHVPVDDFDDAVAARTDQDRYYQILEESDYSALSLNPAMVAERLTTILDTHLSSYQTELRTRTREHGRPSGIIRYWLPATVLLVSSTTIYRIVMGHRTEILASIRDLGRTTIDFFNNWIIEPSKKIVGTIRHDEDSEVSIMSKRSLEGDRASLERMVVDFAVQNPENGSLSELQIAEIRQHVREGDLTPVLKAYEKDMQKPIVGAISGNLIRALLIQIQKTKVDVEVAMSGIDSILKSQELLFGFIGLTPGVMVCIGITRYLQSTFGSRKGVRKSQVSSHIVRVFRNIDRILTNAQPTKYGELFYKDHGLLLCEVHVLRQLASRVLPGRAFHDFLEELEDLVDIRTGVAKQRKVVKRMRWAYAKWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.13
5 0.13
6 0.14
7 0.11
8 0.13
9 0.13
10 0.09
11 0.09
12 0.11
13 0.14
14 0.13
15 0.17
16 0.18
17 0.21
18 0.24
19 0.24
20 0.23
21 0.23
22 0.24
23 0.22
24 0.21
25 0.18
26 0.15
27 0.13
28 0.13
29 0.11
30 0.1
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.12
48 0.14
49 0.14
50 0.14
51 0.17
52 0.21
53 0.22
54 0.25
55 0.27
56 0.3
57 0.35
58 0.38
59 0.43
60 0.48
61 0.51
62 0.56
63 0.61
64 0.58
65 0.57
66 0.58
67 0.58
68 0.49
69 0.46
70 0.4
71 0.34
72 0.31
73 0.27
74 0.24
75 0.16
76 0.16
77 0.14
78 0.13
79 0.1
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.08
89 0.1
90 0.15
91 0.16
92 0.17
93 0.17
94 0.17
95 0.17
96 0.18
97 0.17
98 0.12
99 0.11
100 0.13
101 0.13
102 0.13
103 0.14
104 0.12
105 0.13
106 0.12
107 0.16
108 0.16
109 0.17
110 0.17
111 0.17
112 0.21
113 0.19
114 0.18
115 0.16
116 0.14
117 0.14
118 0.16
119 0.17
120 0.16
121 0.15
122 0.16
123 0.19
124 0.24
125 0.29
126 0.34
127 0.35
128 0.33
129 0.34
130 0.33
131 0.3
132 0.24
133 0.19
134 0.12
135 0.09
136 0.1
137 0.1
138 0.1
139 0.09
140 0.08
141 0.11
142 0.12
143 0.14
144 0.14
145 0.16
146 0.16
147 0.17
148 0.18
149 0.15
150 0.13
151 0.11
152 0.1
153 0.08
154 0.06
155 0.06
156 0.05
157 0.06
158 0.1
159 0.1
160 0.1
161 0.1
162 0.11
163 0.11
164 0.1
165 0.11
166 0.07
167 0.08
168 0.09
169 0.09
170 0.08
171 0.09
172 0.09
173 0.09
174 0.1
175 0.11
176 0.09
177 0.1
178 0.1
179 0.09
180 0.11
181 0.11
182 0.11
183 0.12
184 0.12
185 0.12
186 0.12
187 0.11
188 0.11
189 0.1
190 0.11
191 0.15
192 0.17
193 0.2
194 0.23
195 0.24
196 0.23
197 0.23
198 0.21
199 0.15
200 0.14
201 0.1
202 0.07
203 0.09
204 0.09
205 0.09
206 0.08
207 0.07
208 0.07
209 0.07
210 0.08
211 0.08
212 0.1
213 0.11
214 0.14
215 0.16
216 0.16
217 0.16
218 0.16
219 0.13
220 0.12
221 0.11
222 0.1
223 0.1
224 0.1
225 0.09
226 0.08
227 0.08
228 0.06
229 0.06
230 0.04
231 0.04
232 0.04
233 0.04
234 0.05
235 0.05
236 0.09
237 0.1
238 0.12
239 0.11
240 0.11
241 0.11
242 0.11
243 0.11
244 0.07
245 0.06
246 0.04
247 0.04
248 0.04
249 0.03
250 0.03
251 0.03
252 0.04
253 0.05
254 0.05
255 0.06
256 0.06
257 0.08
258 0.09
259 0.1
260 0.1
261 0.15
262 0.18
263 0.21
264 0.27
265 0.28
266 0.34
267 0.41
268 0.48
269 0.48
270 0.51
271 0.52
272 0.53
273 0.61
274 0.59
275 0.54
276 0.55
277 0.56
278 0.51
279 0.47
280 0.44
281 0.39
282 0.36
283 0.39
284 0.32
285 0.28
286 0.27
287 0.29
288 0.28
289 0.27
290 0.3
291 0.29
292 0.29
293 0.29
294 0.3
295 0.33
296 0.3
297 0.28
298 0.25
299 0.26
300 0.27
301 0.27
302 0.31
303 0.26
304 0.27
305 0.26
306 0.25
307 0.21
308 0.2
309 0.17
310 0.13
311 0.13
312 0.12
313 0.16
314 0.15
315 0.14
316 0.18
317 0.19
318 0.19
319 0.2
320 0.24
321 0.22
322 0.25
323 0.27
324 0.24
325 0.27
326 0.28
327 0.3
328 0.25
329 0.27
330 0.25
331 0.22
332 0.27
333 0.22
334 0.18
335 0.17
336 0.17
337 0.11
338 0.11
339 0.11
340 0.06
341 0.06
342 0.09
343 0.09
344 0.18
345 0.26
346 0.29
347 0.35
348 0.45
349 0.53
350 0.59
351 0.68
352 0.7
353 0.73
354 0.77
355 0.81
356 0.79