Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8BAE1

Protein Details
Accession A0A1S8BAE1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
311-337GVGAWLWWGRRRRRRGGKAGEKRTEILHydrophilic
NLS Segment(s)
PositionSequence
319-334GRRRRRRGGKAGEKRT
Subcellular Location(s) extr 8, mito 6, plas 6, cyto 3.5, cyto_nucl 3, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGAYPSMSYGLHIGSAMHQIPGKLFYGGYDRARCITPPITMSLNSTFSLADIAIGVASGDSAFLNTAGATFIDGLLQSNISGVSVPFSTQPDPGIPYLYLPAATCAAIARHLPVTYNAGLGLYLWNTSDPAYPAIVSSPHYLSFHFHTSRGTSDNTTQAIAVPFALFNLTLTYPVAATDTSYFPCRPYDSEDVNSATVFLGRAFLQAAHLAHNWHTSTAWLAQAPGPRHSAVEEEVKSIDPADTTLSKLPAAPLWNDTWTGVLVPLERGGAAAAGNGSLAGAGDGGSGGLSDGAKAGIGIGVVVGVVGIGVGAWLWWGRRRRRRGGKAGEKRTEILGRERAAGLDDGGFAGVVQRPPEELDGAEMQELPAESERVKELHGKPVQLVHELPGGNRVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.16
4 0.16
5 0.16
6 0.17
7 0.17
8 0.18
9 0.21
10 0.2
11 0.15
12 0.14
13 0.14
14 0.19
15 0.24
16 0.29
17 0.31
18 0.31
19 0.33
20 0.34
21 0.33
22 0.33
23 0.31
24 0.28
25 0.26
26 0.28
27 0.28
28 0.28
29 0.31
30 0.29
31 0.28
32 0.25
33 0.23
34 0.2
35 0.17
36 0.17
37 0.13
38 0.09
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.03
45 0.04
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.06
66 0.07
67 0.06
68 0.06
69 0.06
70 0.05
71 0.06
72 0.06
73 0.07
74 0.09
75 0.12
76 0.13
77 0.14
78 0.15
79 0.15
80 0.18
81 0.18
82 0.18
83 0.15
84 0.14
85 0.15
86 0.14
87 0.13
88 0.1
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08
95 0.09
96 0.09
97 0.1
98 0.1
99 0.11
100 0.11
101 0.12
102 0.16
103 0.15
104 0.15
105 0.13
106 0.11
107 0.11
108 0.1
109 0.1
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.09
119 0.1
120 0.09
121 0.09
122 0.1
123 0.1
124 0.11
125 0.12
126 0.12
127 0.13
128 0.14
129 0.14
130 0.15
131 0.18
132 0.22
133 0.21
134 0.2
135 0.2
136 0.21
137 0.23
138 0.23
139 0.21
140 0.17
141 0.18
142 0.21
143 0.21
144 0.19
145 0.17
146 0.16
147 0.15
148 0.13
149 0.11
150 0.07
151 0.06
152 0.06
153 0.06
154 0.04
155 0.04
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.07
167 0.08
168 0.09
169 0.11
170 0.11
171 0.11
172 0.13
173 0.14
174 0.13
175 0.18
176 0.23
177 0.24
178 0.25
179 0.27
180 0.27
181 0.26
182 0.24
183 0.18
184 0.12
185 0.09
186 0.08
187 0.06
188 0.05
189 0.05
190 0.06
191 0.05
192 0.05
193 0.06
194 0.08
195 0.08
196 0.09
197 0.09
198 0.1
199 0.1
200 0.13
201 0.12
202 0.11
203 0.1
204 0.08
205 0.09
206 0.1
207 0.1
208 0.08
209 0.09
210 0.11
211 0.15
212 0.17
213 0.17
214 0.18
215 0.17
216 0.17
217 0.17
218 0.16
219 0.14
220 0.19
221 0.18
222 0.17
223 0.17
224 0.17
225 0.17
226 0.16
227 0.13
228 0.07
229 0.07
230 0.08
231 0.08
232 0.1
233 0.11
234 0.12
235 0.12
236 0.12
237 0.12
238 0.12
239 0.13
240 0.13
241 0.13
242 0.14
243 0.15
244 0.15
245 0.15
246 0.13
247 0.11
248 0.1
249 0.08
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.03
266 0.03
267 0.03
268 0.02
269 0.02
270 0.02
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.02
293 0.02
294 0.02
295 0.01
296 0.01
297 0.01
298 0.01
299 0.01
300 0.01
301 0.02
302 0.03
303 0.05
304 0.11
305 0.2
306 0.3
307 0.41
308 0.5
309 0.61
310 0.72
311 0.81
312 0.86
313 0.89
314 0.9
315 0.91
316 0.93
317 0.89
318 0.81
319 0.71
320 0.66
321 0.59
322 0.51
323 0.47
324 0.43
325 0.38
326 0.37
327 0.36
328 0.31
329 0.28
330 0.26
331 0.19
332 0.13
333 0.12
334 0.09
335 0.09
336 0.08
337 0.06
338 0.08
339 0.1
340 0.11
341 0.12
342 0.12
343 0.13
344 0.15
345 0.17
346 0.16
347 0.13
348 0.16
349 0.17
350 0.17
351 0.17
352 0.15
353 0.13
354 0.14
355 0.14
356 0.12
357 0.11
358 0.12
359 0.12
360 0.14
361 0.16
362 0.15
363 0.17
364 0.24
365 0.26
366 0.35
367 0.39
368 0.39
369 0.39
370 0.45
371 0.45
372 0.4
373 0.38
374 0.3
375 0.31
376 0.3
377 0.28