Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B8F3

Protein Details
Accession A0A1S8B8F3   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-53NANARNPVAKRKPESKKKDVHRMTEEHydrophilic
NLS Segment(s)
PositionSequence
37-45KRKPESKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
IPR001012  UBX_dom  
IPR003903  UIM_dom  
Pfam View protein in Pfam  
PF00789  UBX  
PROSITE View protein in PROSITE  
PS50033  UBX  
PS50330  UIM  
Amino Acid Sequences KAWSGPPVPKPMDFLMQLHEFLDRYSLNANARNPVAKRKPESKKKDVHRMTEEEMLEMALQQSMAGSNGGGSRDDDPDELTKSASDIKGKNRASESMDVDELSAANGASATDTPFARISSTSPHEEPSNDPRMTTRMHFRHAGGREIRRFALADPVRRIYEWLKASPLEEGKAGAEFELNALGMNLIDHLDQTIEQVGLKNGTIMVEYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.3
4 0.29
5 0.25
6 0.24
7 0.18
8 0.16
9 0.19
10 0.13
11 0.12
12 0.13
13 0.17
14 0.19
15 0.24
16 0.26
17 0.26
18 0.28
19 0.32
20 0.32
21 0.39
22 0.44
23 0.47
24 0.52
25 0.58
26 0.67
27 0.73
28 0.8
29 0.79
30 0.8
31 0.82
32 0.86
33 0.83
34 0.81
35 0.77
36 0.73
37 0.67
38 0.64
39 0.55
40 0.44
41 0.37
42 0.28
43 0.21
44 0.16
45 0.12
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.06
56 0.07
57 0.07
58 0.08
59 0.09
60 0.11
61 0.12
62 0.11
63 0.12
64 0.13
65 0.15
66 0.14
67 0.12
68 0.11
69 0.11
70 0.13
71 0.13
72 0.16
73 0.17
74 0.21
75 0.31
76 0.31
77 0.34
78 0.32
79 0.33
80 0.32
81 0.33
82 0.31
83 0.23
84 0.23
85 0.2
86 0.18
87 0.16
88 0.12
89 0.08
90 0.06
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.07
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.13
107 0.16
108 0.19
109 0.18
110 0.2
111 0.2
112 0.21
113 0.24
114 0.26
115 0.3
116 0.27
117 0.26
118 0.26
119 0.27
120 0.28
121 0.27
122 0.3
123 0.26
124 0.3
125 0.32
126 0.32
127 0.38
128 0.38
129 0.42
130 0.39
131 0.43
132 0.43
133 0.43
134 0.42
135 0.35
136 0.34
137 0.27
138 0.31
139 0.28
140 0.3
141 0.32
142 0.35
143 0.35
144 0.34
145 0.36
146 0.28
147 0.31
148 0.29
149 0.27
150 0.26
151 0.26
152 0.26
153 0.29
154 0.28
155 0.22
156 0.18
157 0.17
158 0.15
159 0.16
160 0.15
161 0.1
162 0.09
163 0.07
164 0.08
165 0.07
166 0.07
167 0.05
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.07
180 0.09
181 0.09
182 0.09
183 0.11
184 0.12
185 0.13
186 0.13
187 0.13
188 0.11
189 0.11