FuNGI

A0A1S8BAI3

Protein Details

Accession

A0A1S8BAI3

Localization Confidence

Medium

Confidence Score

12.2

NoLS Segment(s)

Position	Sequence	Protein Nature
71-90	FPAHKKRTRVSAFKQQRNAA	Hydrophilic

NLS Segment(s)

Position	Sequence
476-486	RKGGGRKKRAV

Subcellular Location(s)

nucl 16, cyto_nucl 12.5, cyto 7, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR013929 RNA_pol_II_AP1_C IPR013930 RNA_pol_II_AP1_N IPR039913 RPAP1/Rba50
Gene Ontology	GO:0006366 P:transcription by RNA polymerase II
Pfam	View protein in Pfam PF08620 RPAP1_C PF08621 RPAP1_N

Amino Acid Sequences

MSALGKGERFYVNFDDPERGIIGDPVESAQAHDDALPVFPGLSFVADVKERDTSEVRPPAAPSFKSTSTGFPAHKKRTRVSAFKQQRNAAKDPSGQPGQDSEPAAPSAAPPVPAAPVREKAPPLVPATAEDGVSAEEIERRQIDEDNRKRLAAMTPEEIEAERQELFSSLNPGFIQRLLARANIDEGSNERSFPSATNLPQTETPPSKSTEPKSPKTAKKVTFEEPKAPEPSTDSAGNDMAKDVGVDTGAAPEGSLPAAPTIHFPRPSQPPELDPNDPNFLQDLHDKYFPDLAADPQSLLWAAPLPTPGSEADKQSPYHPSLRSLDAKDIRFGFNGAIIPPKVARDMSVSLGLHHHGEAPEAAGYTIPELALLARSKVPAQRCMAFQTLGRILFRLGRGEFGVEGTISVEGPEVLQEGHEDELERQNEKDMSMLARGLWECVEEHRVIDTLSEEVNKQSGHLTAKTFAEEALWNWRKGGGRKKRAV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.33
2	0.34
3	0.31
4	0.32
5	0.28
6	0.23
7	0.19
8	0.18
9	0.17
10	0.13
11	0.13
12	0.12
13	0.12
14	0.11
15	0.11
16	0.12
17	0.11
18	0.11
19	0.11
20	0.11
21	0.1
22	0.11
23	0.11
24	0.08
25	0.08
26	0.07
27	0.08
28	0.08
29	0.08
30	0.08
31	0.08
32	0.11
33	0.13
34	0.14
35	0.15
36	0.18
37	0.18
38	0.22
39	0.24
40	0.25
41	0.32
42	0.38
43	0.38
44	0.36
45	0.38
46	0.41
47	0.45
48	0.42
49	0.38
50	0.38
51	0.38
52	0.39
53	0.39
54	0.35
55	0.35
56	0.4
57	0.38
58	0.41
59	0.49
60	0.56
61	0.61
62	0.63
63	0.61
64	0.66
65	0.71
66	0.71
67	0.69
68	0.7
69	0.74
70	0.77
71	0.81
72	0.77
73	0.76
74	0.73
75	0.69
76	0.63
77	0.58
78	0.56
79	0.51
80	0.52
81	0.48
82	0.41
83	0.37
84	0.35
85	0.33
86	0.3
87	0.28
88	0.22
89	0.2
90	0.2
91	0.2
92	0.17
93	0.13
94	0.13
95	0.13
96	0.13
97	0.11
98	0.12
99	0.14
100	0.16
101	0.19
102	0.19
103	0.21
104	0.23
105	0.27
106	0.27
107	0.27
108	0.28
109	0.29
110	0.28
111	0.27
112	0.25
113	0.22
114	0.26
115	0.24
116	0.2
117	0.16
118	0.13
119	0.12
120	0.12
121	0.1
122	0.06
123	0.07
124	0.07
125	0.1
126	0.1
127	0.1
128	0.12
129	0.16
130	0.23
131	0.32
132	0.4
133	0.46
134	0.47
135	0.46
136	0.45
137	0.42
138	0.39
139	0.34
140	0.3
141	0.26
142	0.25
143	0.26
144	0.26
145	0.24
146	0.2
147	0.14
148	0.12
149	0.09
150	0.08
151	0.08
152	0.08
153	0.08
154	0.08
155	0.12
156	0.11
157	0.12
158	0.12
159	0.13
160	0.13
161	0.12
162	0.14
163	0.1
164	0.14
165	0.13
166	0.14
167	0.14
168	0.14
169	0.15
170	0.13
171	0.13
172	0.1
173	0.1
174	0.14
175	0.14
176	0.14
177	0.12
178	0.12
179	0.13
180	0.13
181	0.16
182	0.15
183	0.16
184	0.21
185	0.21
186	0.22
187	0.23
188	0.24
189	0.25
190	0.24
191	0.26
192	0.22
193	0.24
194	0.26
195	0.3
196	0.32
197	0.37
198	0.42
199	0.43
200	0.5
201	0.56
202	0.59
203	0.62
204	0.67
205	0.63
206	0.63
207	0.63
208	0.61
209	0.62
210	0.58
211	0.56
212	0.51
213	0.49
214	0.44
215	0.4
216	0.33
217	0.27
218	0.26
219	0.22
220	0.19
221	0.16
222	0.15
223	0.16
224	0.16
225	0.12
226	0.11
227	0.08
228	0.06
229	0.06
230	0.05
231	0.04
232	0.03
233	0.03
234	0.03
235	0.04
236	0.04
237	0.04
238	0.03
239	0.03
240	0.04
241	0.03
242	0.03
243	0.03
244	0.04
245	0.04
246	0.04
247	0.07
248	0.11
249	0.15
250	0.17
251	0.17
252	0.23
253	0.3
254	0.33
255	0.34
256	0.31
257	0.31
258	0.35
259	0.39
260	0.37
261	0.31
262	0.31
263	0.31
264	0.29
265	0.26
266	0.2
267	0.16
268	0.14
269	0.16
270	0.17
271	0.16
272	0.18
273	0.19
274	0.19
275	0.21
276	0.19
277	0.17
278	0.14
279	0.13
280	0.14
281	0.14
282	0.14
283	0.11
284	0.12
285	0.1
286	0.09
287	0.07
288	0.06
289	0.06
290	0.07
291	0.08
292	0.08
293	0.08
294	0.1
295	0.1
296	0.14
297	0.15
298	0.17
299	0.2
300	0.23
301	0.24
302	0.25
303	0.29
304	0.26
305	0.31
306	0.29
307	0.29
308	0.29
309	0.34
310	0.37
311	0.35
312	0.4
313	0.4
314	0.4
315	0.39
316	0.38
317	0.34
318	0.29
319	0.27
320	0.19
321	0.15
322	0.15
323	0.12
324	0.14
325	0.13
326	0.13
327	0.13
328	0.14
329	0.13
330	0.12
331	0.13
332	0.13
333	0.15
334	0.16
335	0.21
336	0.2
337	0.19
338	0.2
339	0.2
340	0.16
341	0.15
342	0.15
343	0.1
344	0.11
345	0.1
346	0.1
347	0.1
348	0.09
349	0.09
350	0.07
351	0.07
352	0.07
353	0.07
354	0.05
355	0.05
356	0.05
357	0.05
358	0.08
359	0.09
360	0.1
361	0.11
362	0.12
363	0.15
364	0.19
365	0.23
366	0.26
367	0.3
368	0.32
369	0.33
370	0.36
371	0.37
372	0.33
373	0.3
374	0.3
375	0.3
376	0.28
377	0.27
378	0.22
379	0.21
380	0.23
381	0.24
382	0.22
383	0.19
384	0.19
385	0.19
386	0.2
387	0.19
388	0.16
389	0.15
390	0.1
391	0.1
392	0.08
393	0.08
394	0.07
395	0.07
396	0.06
397	0.05
398	0.05
399	0.05
400	0.05
401	0.05
402	0.05
403	0.06
404	0.07
405	0.08
406	0.09
407	0.09
408	0.11
409	0.19
410	0.21
411	0.22
412	0.21
413	0.25
414	0.25
415	0.24
416	0.23
417	0.18
418	0.18
419	0.18
420	0.19
421	0.14
422	0.18
423	0.18
424	0.17
425	0.15
426	0.14
427	0.13
428	0.15
429	0.19
430	0.15
431	0.16
432	0.17
433	0.17
434	0.16
435	0.16
436	0.14
437	0.12
438	0.13
439	0.14
440	0.13
441	0.14
442	0.17
443	0.16
444	0.15
445	0.15
446	0.18
447	0.22
448	0.24
449	0.26
450	0.27
451	0.29
452	0.3
453	0.28
454	0.24
455	0.22
456	0.2
457	0.19
458	0.26
459	0.29
460	0.27
461	0.27
462	0.32
463	0.36
464	0.43
465	0.52
466	0.52

A0A1S8BAI3

3D AlphaFold-predicted Structure Viewer