Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8B6G5

Protein Details
Accession A0A1S8B6G5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11.5, cyto_nucl 9.833, mito_nucl 7.833, mito 7.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences APAATGGKKQKKKWSKGKVKDKAQHAVVLDKTTNDKLQKDVQSYRLITVAILVDRLKINGSLARKALADLEEKGQIKKVVHHSKLQVYSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.89
4 0.93
5 0.92
6 0.92
7 0.89
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.4
15 0.35
16 0.29
17 0.22
18 0.23
19 0.21
20 0.23
21 0.21
22 0.2
23 0.2
24 0.27
25 0.3
26 0.32
27 0.33
28 0.33
29 0.35
30 0.34
31 0.32
32 0.26
33 0.22
34 0.17
35 0.15
36 0.12
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.08
46 0.11
47 0.14
48 0.15
49 0.16
50 0.17
51 0.16
52 0.17
53 0.18
54 0.15
55 0.16
56 0.14
57 0.16
58 0.21
59 0.22
60 0.22
61 0.24
62 0.26
63 0.25
64 0.3
65 0.39
66 0.44
67 0.46
68 0.53
69 0.55
70 0.61