Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2DS89

Protein Details
Accession A0A0G2DS89    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42ARIKKSKKGTHTQTKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKSKK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDASSARIKKSKKGTHTQTKFKVRCHRYLYTLVLKDSDKAEKLKQSLPPGLTITDVPKKNAKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.53
9 0.58
10 0.57
11 0.63
12 0.64
13 0.65
14 0.69
15 0.67
16 0.63
17 0.65
18 0.67
19 0.7
20 0.77
21 0.79
22 0.77
23 0.8
24 0.76
25 0.73
26 0.74
27 0.67
28 0.67
29 0.64
30 0.58
31 0.51
32 0.52
33 0.5
34 0.47
35 0.44
36 0.36
37 0.32
38 0.29
39 0.27
40 0.24
41 0.22
42 0.17
43 0.18
44 0.22
45 0.25
46 0.28
47 0.31
48 0.35
49 0.38
50 0.41
51 0.39
52 0.39
53 0.35
54 0.33
55 0.29
56 0.25
57 0.25
58 0.28
59 0.28
60 0.29
61 0.34
62 0.38
63 0.45
64 0.51