Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8B528

Protein Details
Accession A0A1S8B528    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-31AEPQKLKVDKRQKLKVDKRDPEPQKLKBasic
NLS Segment(s)
PositionSequence
9-142KLKVDKRQKLKVDKRDPEPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPE
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKREAEPQKLKVDKRQKLKVDKRDPEPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPEPQKLKVDKREPEPQKLKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.76
4 0.8
5 0.86
6 0.87
7 0.87
8 0.87
9 0.84
10 0.85
11 0.81
12 0.81
13 0.78
14 0.74
15 0.73
16 0.73
17 0.74
18 0.73
19 0.76
20 0.72
21 0.71
22 0.75
23 0.7
24 0.71
25 0.71
26 0.67
27 0.68
28 0.7
29 0.71
30 0.7
31 0.73
32 0.69
33 0.69
34 0.73
35 0.69
36 0.71
37 0.71
38 0.67
39 0.68
40 0.7
41 0.71
42 0.7
43 0.73
44 0.69
45 0.71
46 0.75
47 0.69
48 0.66
49 0.69
50 0.68
51 0.68
52 0.72
53 0.72
54 0.68
55 0.71
56 0.75
57 0.71
58 0.73
59 0.71
60 0.67
61 0.68
62 0.7
63 0.71
64 0.7
65 0.73
66 0.69
67 0.69
68 0.73
69 0.69
70 0.71
71 0.71
72 0.67
73 0.68
74 0.7
75 0.71
76 0.7
77 0.73
78 0.69
79 0.71
80 0.75
81 0.69
82 0.66
83 0.69
84 0.68
85 0.68
86 0.72
87 0.72
88 0.68
89 0.71
90 0.75
91 0.71
92 0.73
93 0.71
94 0.67
95 0.68
96 0.7
97 0.71
98 0.7
99 0.73
100 0.69
101 0.69
102 0.73
103 0.69
104 0.71
105 0.71
106 0.67
107 0.68
108 0.7
109 0.71
110 0.7
111 0.73
112 0.69
113 0.69
114 0.73
115 0.69
116 0.71
117 0.71
118 0.67
119 0.68
120 0.7
121 0.71
122 0.7
123 0.73
124 0.69
125 0.69
126 0.73
127 0.69
128 0.71
129 0.71