Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2ELR7

Protein Details
Accession A0A0G2ELR7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-166PCIGNARVKRWKRAHRLGMNPPIEHydrophilic
NLS Segment(s)
PositionSequence
109-117KEKERARKA
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPKRRASGPQTRQATLAFHGASNRVTKPRGSPTGKAKATNKSKQDPILSESITETNLKAEADPEPTEPTTSELAIAQQSQKEAAKAKVSPEEKEASRITETQIKKYWKEKERARKAPRVHQQDVSLHEKVLREFDTSGQYGPCIGNARVKRWKRAHRLGMNPPIEVLAVLLKEGKENTKAQRAYVDELLRSRFVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.39
4 0.35
5 0.26
6 0.21
7 0.22
8 0.22
9 0.23
10 0.24
11 0.26
12 0.25
13 0.26
14 0.27
15 0.32
16 0.39
17 0.47
18 0.48
19 0.51
20 0.56
21 0.64
22 0.65
23 0.65
24 0.61
25 0.62
26 0.66
27 0.67
28 0.65
29 0.61
30 0.63
31 0.62
32 0.62
33 0.55
34 0.49
35 0.46
36 0.38
37 0.32
38 0.29
39 0.24
40 0.21
41 0.18
42 0.14
43 0.1
44 0.11
45 0.1
46 0.08
47 0.09
48 0.09
49 0.12
50 0.13
51 0.14
52 0.16
53 0.16
54 0.17
55 0.16
56 0.17
57 0.14
58 0.13
59 0.12
60 0.09
61 0.1
62 0.1
63 0.11
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.13
71 0.15
72 0.17
73 0.17
74 0.19
75 0.25
76 0.26
77 0.25
78 0.25
79 0.27
80 0.24
81 0.27
82 0.25
83 0.2
84 0.2
85 0.19
86 0.18
87 0.22
88 0.23
89 0.23
90 0.29
91 0.3
92 0.32
93 0.38
94 0.46
95 0.45
96 0.53
97 0.57
98 0.63
99 0.7
100 0.78
101 0.78
102 0.76
103 0.75
104 0.76
105 0.77
106 0.75
107 0.68
108 0.6
109 0.57
110 0.53
111 0.53
112 0.49
113 0.4
114 0.31
115 0.29
116 0.27
117 0.23
118 0.23
119 0.19
120 0.15
121 0.15
122 0.17
123 0.19
124 0.19
125 0.19
126 0.16
127 0.15
128 0.14
129 0.13
130 0.13
131 0.13
132 0.13
133 0.2
134 0.23
135 0.3
136 0.39
137 0.43
138 0.51
139 0.57
140 0.66
141 0.69
142 0.77
143 0.81
144 0.8
145 0.85
146 0.85
147 0.85
148 0.76
149 0.66
150 0.55
151 0.45
152 0.36
153 0.27
154 0.17
155 0.1
156 0.07
157 0.08
158 0.09
159 0.09
160 0.11
161 0.13
162 0.15
163 0.18
164 0.23
165 0.29
166 0.37
167 0.38
168 0.38
169 0.43
170 0.43
171 0.45
172 0.47
173 0.43
174 0.37
175 0.4
176 0.42
177 0.36