Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8BJA4

Protein Details
Accession A0A1S8BJA4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-95AQKMHAKRVERLKRREKRNKKLNSBasic
NLS Segment(s)
PositionSequence
22-94KRAEDRKALAAVKAKEKEMKDEKEAERQTRVAAIKEKREKKAERERYEQMAQKMHAKRVERLKRREKRNKKLN
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences GKQWHQPKKAFRPGSGLTSYAKRAEDRKALAAVKAKEKEMKDEKEAERQTRVAAIKEKREKKAERERYEQMAQKMHAKRVERLKRREKRNKKLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.53
3 0.44
4 0.36
5 0.34
6 0.35
7 0.29
8 0.28
9 0.24
10 0.25
11 0.3
12 0.33
13 0.33
14 0.33
15 0.35
16 0.34
17 0.35
18 0.38
19 0.35
20 0.36
21 0.35
22 0.33
23 0.33
24 0.33
25 0.38
26 0.39
27 0.4
28 0.36
29 0.41
30 0.42
31 0.46
32 0.48
33 0.42
34 0.36
35 0.33
36 0.3
37 0.28
38 0.27
39 0.2
40 0.25
41 0.27
42 0.34
43 0.43
44 0.49
45 0.49
46 0.56
47 0.58
48 0.6
49 0.68
50 0.69
51 0.67
52 0.67
53 0.67
54 0.66
55 0.68
56 0.63
57 0.56
58 0.51
59 0.46
60 0.48
61 0.47
62 0.47
63 0.47
64 0.44
65 0.47
66 0.53
67 0.62
68 0.63
69 0.69
70 0.74
71 0.78
72 0.86
73 0.91
74 0.91
75 0.92