Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8BKX0

Protein Details
Accession A0A1S8BKX0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-76ANLTTEKQKKKQIHFPQRVYAVKHydrophilic
NLS Segment(s)
PositionSequence
39-48RKQTRAMRRR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Amino Acid Sequences IHDVRKSIARVLTVINKNQREQLRLFYKGKKYLPLDLRRKQTRAMRRRLTKHEANLTTEKQKKKQIHFPQRVYAVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.44
4 0.44
5 0.5
6 0.49
7 0.44
8 0.41
9 0.43
10 0.4
11 0.44
12 0.47
13 0.47
14 0.5
15 0.53
16 0.53
17 0.51
18 0.47
19 0.49
20 0.54
21 0.56
22 0.59
23 0.58
24 0.66
25 0.63
26 0.62
27 0.59
28 0.58
29 0.59
30 0.59
31 0.63
32 0.64
33 0.68
34 0.75
35 0.77
36 0.77
37 0.73
38 0.71
39 0.7
40 0.63
41 0.6
42 0.58
43 0.54
44 0.55
45 0.56
46 0.55
47 0.52
48 0.58
49 0.61
50 0.64
51 0.71
52 0.73
53 0.77
54 0.81
55 0.81
56 0.81
57 0.81