FuNGI

A0A1S8B876

Protein Details

Accession

A0A1S8B876

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
2-26	SQQRMLPHTVRIKRKRQDEPVETLH	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto_nucl 12, cyto 6, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR040150 Iwr1 IPR013883 TF_Iwr1_dom
Gene Ontology	GO:0006606 P:protein import into nucleus
Pfam	View protein in Pfam PF08574 Iwr1

Amino Acid Sequences

MSQQRMLPHTVRIKRKRQDEPVETLHVHYTPQQQLKQDDPKKRRFTLDQPASSHPAEFRRVLQQDPAVGGASASIVAEGATSSLAAAGPTTATTVTTTSPGPTTTTASPAPSSISDRKILAPATATRRFHLSTKSAPSPSSSPGGPLQKRKNVATLVESKPKKTRTATAAGAASSSNTPDVEMSDDEPGAKPHQQPPTTLKRPGRTARSASPAVGTNGATPTTTPATAATANNTKDKSAKVGAAPVDPGLLSEMQKFAQEVEHAEGQRERAAPAVTTTPSKPTPIYPPTMASPTPQKLKFQPKATPRYRDRHPERFSSSANNSNGADGMDIDTKHESDSDDSDGDYVYDTYIRYDGPSSDTITDSKPLSTTTTVPSPPLPTTTTTDIGILVIDIDQQPLWETYLDPDAADAAAASDKEFDTDDEDENAEDFYANEYPEDEVASDDERDEGAYAYRVAASDEEEWDRDAPEWSDDEEEGEVDLRRPWGRGVGVGAGRRPAWLKGGGGGGGGKGSDSE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.83
3	0.85
4	0.86
5	0.88
6	0.84
7	0.82
8	0.78
9	0.76
10	0.67
11	0.58
12	0.51
13	0.4
14	0.34
15	0.31
16	0.33
17	0.35
18	0.41
19	0.43
20	0.46
21	0.5
22	0.58
23	0.63
24	0.64
25	0.66
26	0.68
27	0.75
28	0.78
29	0.78
30	0.77
31	0.74
32	0.75
33	0.76
34	0.76
35	0.73
36	0.69
37	0.69
38	0.67
39	0.59
40	0.51
41	0.44
42	0.38
43	0.36
44	0.33
45	0.31
46	0.35
47	0.37
48	0.37
49	0.39
50	0.37
51	0.34
52	0.34
53	0.31
54	0.22
55	0.2
56	0.18
57	0.12
58	0.1
59	0.07
60	0.06
61	0.04
62	0.04
63	0.04
64	0.04
65	0.04
66	0.04
67	0.03
68	0.03
69	0.03
70	0.04
71	0.04
72	0.04
73	0.04
74	0.04
75	0.04
76	0.05
77	0.06
78	0.05
79	0.06
80	0.07
81	0.08
82	0.09
83	0.1
84	0.11
85	0.11
86	0.12
87	0.13
88	0.14
89	0.14
90	0.18
91	0.17
92	0.21
93	0.2
94	0.21
95	0.21
96	0.19
97	0.2
98	0.18
99	0.23
100	0.24
101	0.26
102	0.26
103	0.27
104	0.28
105	0.29
106	0.28
107	0.23
108	0.21
109	0.24
110	0.3
111	0.36
112	0.35
113	0.33
114	0.37
115	0.37
116	0.37
117	0.37
118	0.34
119	0.34
120	0.4
121	0.45
122	0.43
123	0.41
124	0.42
125	0.38
126	0.36
127	0.32
128	0.24
129	0.21
130	0.25
131	0.34
132	0.35
133	0.42
134	0.47
135	0.51
136	0.55
137	0.54
138	0.54
139	0.47
140	0.45
141	0.41
142	0.41
143	0.4
144	0.45
145	0.45
146	0.42
147	0.46
148	0.47
149	0.47
150	0.43
151	0.44
152	0.41
153	0.47
154	0.45
155	0.43
156	0.41
157	0.35
158	0.32
159	0.25
160	0.2
161	0.13
162	0.11
163	0.08
164	0.06
165	0.07
166	0.06
167	0.07
168	0.08
169	0.09
170	0.1
171	0.1
172	0.1
173	0.11
174	0.11
175	0.12
176	0.12
177	0.15
178	0.16
179	0.22
180	0.3
181	0.3
182	0.33
183	0.39
184	0.47
185	0.49
186	0.53
187	0.52
188	0.49
189	0.56
190	0.59
191	0.6
192	0.55
193	0.54
194	0.52
195	0.53
196	0.49
197	0.41
198	0.36
199	0.3
200	0.26
201	0.22
202	0.17
203	0.12
204	0.12
205	0.11
206	0.1
207	0.08
208	0.09
209	0.09
210	0.09
211	0.08
212	0.08
213	0.09
214	0.11
215	0.12
216	0.12
217	0.16
218	0.17
219	0.2
220	0.2
221	0.19
222	0.19
223	0.2
224	0.2
225	0.17
226	0.18
227	0.15
228	0.19
229	0.19
230	0.18
231	0.18
232	0.14
233	0.12
234	0.1
235	0.09
236	0.06
237	0.06
238	0.06
239	0.06
240	0.07
241	0.07
242	0.08
243	0.08
244	0.07
245	0.07
246	0.07
247	0.08
248	0.1
249	0.13
250	0.12
251	0.13
252	0.14
253	0.13
254	0.15
255	0.14
256	0.12
257	0.11
258	0.11
259	0.1
260	0.11
261	0.12
262	0.11
263	0.12
264	0.13
265	0.14
266	0.15
267	0.16
268	0.16
269	0.16
270	0.22
271	0.24
272	0.27
273	0.24
274	0.25
275	0.26
276	0.28
277	0.26
278	0.2
279	0.23
280	0.23
281	0.29
282	0.28
283	0.29
284	0.34
285	0.45
286	0.5
287	0.49
288	0.53
289	0.55
290	0.64
291	0.68
292	0.7
293	0.66
294	0.66
295	0.66
296	0.7
297	0.69
298	0.7
299	0.67
300	0.65
301	0.63
302	0.6
303	0.56
304	0.52
305	0.48
306	0.45
307	0.42
308	0.37
309	0.32
310	0.28
311	0.27
312	0.2
313	0.16
314	0.08
315	0.09
316	0.09
317	0.09
318	0.1
319	0.1
320	0.1
321	0.1
322	0.11
323	0.1
324	0.09
325	0.12
326	0.13
327	0.12
328	0.12
329	0.12
330	0.11
331	0.11
332	0.09
333	0.07
334	0.05
335	0.06
336	0.06
337	0.07
338	0.07
339	0.07
340	0.08
341	0.09
342	0.09
343	0.12
344	0.14
345	0.15
346	0.16
347	0.17
348	0.17
349	0.17
350	0.19
351	0.16
352	0.15
353	0.13
354	0.13
355	0.15
356	0.16
357	0.16
358	0.17
359	0.22
360	0.22
361	0.23
362	0.24
363	0.24
364	0.23
365	0.23
366	0.21
367	0.19
368	0.23
369	0.26
370	0.26
371	0.23
372	0.23
373	0.2
374	0.19
375	0.15
376	0.1
377	0.06
378	0.05
379	0.06
380	0.05
381	0.06
382	0.06
383	0.06
384	0.08
385	0.08
386	0.09
387	0.08
388	0.08
389	0.09
390	0.13
391	0.13
392	0.11
393	0.11
394	0.1
395	0.1
396	0.09
397	0.07
398	0.04
399	0.06
400	0.06
401	0.06
402	0.07
403	0.07
404	0.08
405	0.09
406	0.09
407	0.12
408	0.14
409	0.15
410	0.16
411	0.16
412	0.15
413	0.15
414	0.15
415	0.1
416	0.08
417	0.07
418	0.08
419	0.1
420	0.1
421	0.09
422	0.1
423	0.11
424	0.11
425	0.12
426	0.09
427	0.08
428	0.1
429	0.11
430	0.11
431	0.1
432	0.1
433	0.1
434	0.1
435	0.1
436	0.09
437	0.08
438	0.09
439	0.1
440	0.1
441	0.1
442	0.1
443	0.11
444	0.11
445	0.12
446	0.13
447	0.16
448	0.17
449	0.17
450	0.19
451	0.19
452	0.19
453	0.17
454	0.18
455	0.16
456	0.16
457	0.17
458	0.17
459	0.19
460	0.18
461	0.18
462	0.16
463	0.15
464	0.13
465	0.13
466	0.12
467	0.11
468	0.13
469	0.16
470	0.16
471	0.17
472	0.18
473	0.22
474	0.23
475	0.24
476	0.25
477	0.28
478	0.32
479	0.34
480	0.35
481	0.32
482	0.31
483	0.31
484	0.3
485	0.24
486	0.24
487	0.24
488	0.23
489	0.23
490	0.26
491	0.23
492	0.22
493	0.21
494	0.17
495	0.14
496	0.13

A0A1S8B876

3D AlphaFold-predicted Structure Viewer