Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FD42

Protein Details
Accession A0A0C4FD42    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-37FEYSKEKWDKKHKVPSFKIGDHydrophilic
NLS Segment(s)
PositionSequence
128-137HKILKDKKIR
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MLDKARKHAQQSMDNAFEYSKEKWDKKHKVPSFKIGDLVLISTTNFTNIKGPKKLRNAFVGPFVVKALHGPNAVEVELYGELEKKHPTFPVSLLKHYNESDAELFPLRKEIPEAEVPPLEESEEKKIHKILKDKKIRGEKDKLYLVRYRNPIHEDEWLPEKDIKDADKYLRRFKNSKHKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.4
4 0.34
5 0.29
6 0.24
7 0.25
8 0.3
9 0.33
10 0.41
11 0.52
12 0.61
13 0.67
14 0.76
15 0.76
16 0.79
17 0.82
18 0.83
19 0.79
20 0.7
21 0.63
22 0.52
23 0.45
24 0.34
25 0.29
26 0.19
27 0.12
28 0.1
29 0.09
30 0.08
31 0.1
32 0.09
33 0.09
34 0.15
35 0.2
36 0.26
37 0.33
38 0.38
39 0.44
40 0.54
41 0.59
42 0.56
43 0.58
44 0.56
45 0.5
46 0.49
47 0.44
48 0.34
49 0.29
50 0.26
51 0.19
52 0.14
53 0.14
54 0.11
55 0.11
56 0.11
57 0.1
58 0.11
59 0.12
60 0.12
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.08
70 0.1
71 0.09
72 0.1
73 0.11
74 0.12
75 0.13
76 0.16
77 0.24
78 0.24
79 0.26
80 0.28
81 0.28
82 0.3
83 0.28
84 0.27
85 0.18
86 0.17
87 0.16
88 0.13
89 0.13
90 0.12
91 0.12
92 0.1
93 0.12
94 0.1
95 0.09
96 0.1
97 0.1
98 0.12
99 0.16
100 0.18
101 0.18
102 0.19
103 0.19
104 0.18
105 0.18
106 0.15
107 0.12
108 0.13
109 0.17
110 0.21
111 0.21
112 0.22
113 0.26
114 0.3
115 0.34
116 0.42
117 0.46
118 0.51
119 0.61
120 0.65
121 0.7
122 0.76
123 0.77
124 0.76
125 0.75
126 0.7
127 0.67
128 0.7
129 0.63
130 0.57
131 0.56
132 0.52
133 0.51
134 0.53
135 0.49
136 0.47
137 0.48
138 0.47
139 0.43
140 0.46
141 0.4
142 0.36
143 0.39
144 0.34
145 0.33
146 0.33
147 0.31
148 0.27
149 0.29
150 0.27
151 0.26
152 0.3
153 0.36
154 0.42
155 0.47
156 0.54
157 0.59
158 0.64
159 0.65
160 0.71