Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JJ00

Protein Details
Accession A0A1G4JJ00    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-115LARAKSKQGSKVLKRRREKGRWYLTHHydrophilic
NLS Segment(s)
PositionSequence
81-110LKRKRRVGFLARAKSKQGSKVLKRRREKGR
Subcellular Location(s) mito 22.5, cyto_mito 12.333, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSFLTKSILQFSARRNFSLVSSFSPFNAGLLRSSPLQSTSTSMADRTVSQPAQSFPLINSIFGFTQRRWKSRGNTFQPSTLKRKRRVGFLARAKSKQGSKVLKRRREKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.34
5 0.35
6 0.29
7 0.24
8 0.27
9 0.26
10 0.24
11 0.26
12 0.24
13 0.19
14 0.19
15 0.15
16 0.11
17 0.12
18 0.14
19 0.12
20 0.13
21 0.13
22 0.13
23 0.14
24 0.13
25 0.15
26 0.16
27 0.16
28 0.16
29 0.16
30 0.15
31 0.14
32 0.15
33 0.14
34 0.15
35 0.13
36 0.14
37 0.15
38 0.15
39 0.17
40 0.16
41 0.14
42 0.1
43 0.18
44 0.17
45 0.16
46 0.15
47 0.14
48 0.13
49 0.15
50 0.17
51 0.1
52 0.21
53 0.25
54 0.27
55 0.3
56 0.36
57 0.41
58 0.5
59 0.6
60 0.58
61 0.63
62 0.62
63 0.65
64 0.65
65 0.63
66 0.62
67 0.61
68 0.62
69 0.61
70 0.69
71 0.65
72 0.68
73 0.72
74 0.71
75 0.72
76 0.74
77 0.76
78 0.73
79 0.71
80 0.66
81 0.63
82 0.58
83 0.55
84 0.54
85 0.54
86 0.58
87 0.67
88 0.74
89 0.78
90 0.83
91 0.86
92 0.87
93 0.87
94 0.87
95 0.87