Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4J0H6

Protein Details
Accession A0A1G4J0H6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
231-259SVDKQPAESKEERRQRKRREGLLRQQQASHydrophilic
NLS Segment(s)
PositionSequence
243-249RRQRKRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003827  tRNA_yW-synthesising  
IPR036602  tRNA_yW-synthesising-like_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF02676  TYW3  
Amino Acid Sequences MSQNAFDQKKQHILSEIQSDSLDLSPKGTIDELCWPIMNLINSHADMVTTSSCSGRLSVFVEGQKLHNEVLKSGGKGEGGKWLFVSHNQNEVRNWIQRLSEPIHWVSEPDNSQLDPTSRLILYKFEPFILHVKCRSFHIASQLFNTAMSCGFRESGIGSNNIVAVRINIKLDVPIGYLDQETRELRFFVSPAYIKLIDEMTLAKYNENARKMQELLKKIDSQVITISEQGSVDKQPAESKEERRQRKRREGLLRQQQAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.41
4 0.33
5 0.32
6 0.29
7 0.25
8 0.23
9 0.21
10 0.13
11 0.13
12 0.13
13 0.13
14 0.14
15 0.14
16 0.12
17 0.12
18 0.2
19 0.21
20 0.21
21 0.21
22 0.2
23 0.2
24 0.23
25 0.22
26 0.15
27 0.15
28 0.17
29 0.17
30 0.18
31 0.16
32 0.12
33 0.11
34 0.13
35 0.11
36 0.09
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.1
43 0.11
44 0.12
45 0.14
46 0.17
47 0.17
48 0.19
49 0.19
50 0.2
51 0.21
52 0.2
53 0.18
54 0.17
55 0.17
56 0.15
57 0.2
58 0.21
59 0.19
60 0.18
61 0.19
62 0.17
63 0.17
64 0.17
65 0.2
66 0.18
67 0.18
68 0.17
69 0.17
70 0.17
71 0.21
72 0.27
73 0.2
74 0.28
75 0.29
76 0.31
77 0.3
78 0.33
79 0.32
80 0.3
81 0.29
82 0.23
83 0.22
84 0.21
85 0.26
86 0.25
87 0.24
88 0.23
89 0.23
90 0.22
91 0.21
92 0.21
93 0.18
94 0.18
95 0.16
96 0.15
97 0.15
98 0.13
99 0.14
100 0.14
101 0.14
102 0.12
103 0.12
104 0.12
105 0.11
106 0.11
107 0.12
108 0.13
109 0.13
110 0.14
111 0.14
112 0.13
113 0.13
114 0.14
115 0.19
116 0.19
117 0.19
118 0.19
119 0.2
120 0.2
121 0.22
122 0.25
123 0.21
124 0.2
125 0.27
126 0.27
127 0.27
128 0.28
129 0.27
130 0.23
131 0.21
132 0.2
133 0.11
134 0.09
135 0.08
136 0.07
137 0.06
138 0.07
139 0.06
140 0.07
141 0.08
142 0.11
143 0.12
144 0.12
145 0.11
146 0.11
147 0.13
148 0.12
149 0.11
150 0.07
151 0.07
152 0.08
153 0.09
154 0.09
155 0.08
156 0.08
157 0.08
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.08
167 0.11
168 0.11
169 0.12
170 0.13
171 0.13
172 0.14
173 0.14
174 0.14
175 0.11
176 0.15
177 0.15
178 0.15
179 0.19
180 0.19
181 0.18
182 0.19
183 0.18
184 0.14
185 0.13
186 0.13
187 0.11
188 0.15
189 0.16
190 0.15
191 0.18
192 0.24
193 0.3
194 0.32
195 0.31
196 0.29
197 0.32
198 0.35
199 0.39
200 0.4
201 0.39
202 0.42
203 0.45
204 0.45
205 0.42
206 0.46
207 0.38
208 0.32
209 0.3
210 0.26
211 0.23
212 0.21
213 0.21
214 0.16
215 0.15
216 0.15
217 0.14
218 0.12
219 0.13
220 0.13
221 0.14
222 0.18
223 0.21
224 0.27
225 0.32
226 0.39
227 0.48
228 0.57
229 0.66
230 0.72
231 0.8
232 0.84
233 0.88
234 0.9
235 0.9
236 0.92
237 0.91
238 0.92
239 0.93