Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FC92

Protein Details
Accession A0A0C4FC92    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-84KQTGHFSRECPKKKNRINNVGMEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito_nucl 13.333, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences RVMKRNKPVTNNYNPLNNPLNRSQWRNNPAPEKADKPSDSSTKKNPVSAPEKEKLMCHFCKQTGHFSRECPKKKNRINNVGMEDDDDPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.57
4 0.5
5 0.44
6 0.41
7 0.47
8 0.44
9 0.5
10 0.51
11 0.53
12 0.57
13 0.58
14 0.6
15 0.58
16 0.56
17 0.54
18 0.51
19 0.46
20 0.43
21 0.43
22 0.37
23 0.35
24 0.36
25 0.39
26 0.39
27 0.39
28 0.42
29 0.45
30 0.45
31 0.44
32 0.41
33 0.4
34 0.42
35 0.44
36 0.44
37 0.37
38 0.39
39 0.36
40 0.36
41 0.34
42 0.35
43 0.31
44 0.29
45 0.31
46 0.31
47 0.37
48 0.38
49 0.44
50 0.45
51 0.48
52 0.45
53 0.46
54 0.53
55 0.57
56 0.62
57 0.6
58 0.62
59 0.68
60 0.76
61 0.82
62 0.83
63 0.83
64 0.83
65 0.84
66 0.8
67 0.72
68 0.63
69 0.55