Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J7E6

Protein Details
Accession A0A1G4J7E6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22STPSDKKQKLEEKPKPCCVCKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR007745  Cyt_c_oxidase_Cu-chaperone  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0016531  F:copper chaperone activity  
GO:0005507  F:copper ion binding  
Pfam View protein in Pfam  
PF05051  COX17  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSTPSDKKQKLEEKPKPCCVCKPEKEDRDTCLLFNGQESGKCDDMIAKYKKCMQGYGFSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.82
4 0.76
5 0.73
6 0.68
7 0.69
8 0.66
9 0.66
10 0.67
11 0.67
12 0.7
13 0.64
14 0.6
15 0.56
16 0.49
17 0.4
18 0.31
19 0.25
20 0.19
21 0.17
22 0.16
23 0.1
24 0.11
25 0.15
26 0.17
27 0.17
28 0.17
29 0.16
30 0.18
31 0.21
32 0.28
33 0.32
34 0.3
35 0.33
36 0.4
37 0.47
38 0.45
39 0.47
40 0.41