Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JAW0

Protein Details
Accession A0A1G4JAW0   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGFGGQTKQIFHKKAKVTKKVVLRLECVVCKTRAQLPLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.9
5 0.89
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.89
12 0.82
13 0.82
14 0.75
15 0.7
16 0.62
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.62
32 0.61
33 0.61
34 0.6
35 0.61
36 0.58
37 0.54
38 0.47
39 0.4
40 0.37
41 0.3
42 0.32
43 0.31
44 0.3
45 0.29
46 0.34
47 0.38
48 0.44
49 0.53
50 0.57
51 0.58
52 0.61
53 0.67
54 0.67
55 0.66
56 0.61
57 0.54
58 0.5
59 0.47
60 0.43
61 0.37
62 0.33
63 0.27
64 0.25
65 0.25
66 0.27
67 0.31
68 0.36
69 0.4
70 0.46
71 0.56
72 0.63
73 0.66
74 0.63
75 0.6
76 0.61
77 0.57
78 0.56
79 0.56
80 0.57
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57