Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4K2V4

Protein Details
Accession A0A1G4K2V4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
186-205AVYIIKKDKVTKRYLKTRQDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 12.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029055  Ntn_hydrolases_N  
IPR033811  Proteasome_beta_3  
IPR016050  Proteasome_bsu_CS  
IPR001353  Proteasome_sua/b  
IPR023333  Proteasome_suB-type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0019774  C:proteasome core complex, beta-subunit complex  
GO:0010499  P:proteasomal ubiquitin-independent protein catabolic process  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00227  Proteasome  
PROSITE View protein in PROSITE  
PS00854  PROTEASOME_BETA_1  
PS51476  PROTEASOME_BETA_2  
CDD cd03759  proteasome_beta_type_3  
Amino Acid Sequences MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVANNFEKIFHYGHVFLGLTGLATDVTTLSELFRYKTNLYKLKEDRLIEPDTLTQLVSSTLYEKRFGPYFTGPVVAGLNSKTGKPYIAGFDLIGCIDEAKDFVVSGTASEQLFGMCESLYEPNLEAEDLFETISQALLNAADRDALSGWGAAVYIIKKDKVTKRYLKTRQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.05
5 0.06
6 0.06
7 0.06
8 0.07
9 0.09
10 0.09
11 0.09
12 0.11
13 0.11
14 0.11
15 0.12
16 0.12
17 0.1
18 0.11
19 0.11
20 0.11
21 0.13
22 0.12
23 0.13
24 0.12
25 0.16
26 0.14
27 0.14
28 0.14
29 0.15
30 0.16
31 0.16
32 0.18
33 0.15
34 0.16
35 0.18
36 0.16
37 0.13
38 0.12
39 0.11
40 0.07
41 0.06
42 0.06
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.08
53 0.09
54 0.11
55 0.14
56 0.15
57 0.21
58 0.28
59 0.34
60 0.36
61 0.45
62 0.46
63 0.49
64 0.53
65 0.49
66 0.44
67 0.41
68 0.4
69 0.31
70 0.29
71 0.22
72 0.18
73 0.17
74 0.14
75 0.09
76 0.07
77 0.07
78 0.06
79 0.06
80 0.07
81 0.1
82 0.11
83 0.12
84 0.13
85 0.14
86 0.16
87 0.16
88 0.17
89 0.16
90 0.16
91 0.15
92 0.16
93 0.14
94 0.13
95 0.13
96 0.09
97 0.08
98 0.07
99 0.09
100 0.08
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.11
107 0.11
108 0.12
109 0.12
110 0.11
111 0.11
112 0.11
113 0.1
114 0.09
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.08
129 0.08
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.04
137 0.04
138 0.06
139 0.07
140 0.08
141 0.08
142 0.09
143 0.09
144 0.09
145 0.09
146 0.08
147 0.07
148 0.08
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.09
165 0.09
166 0.09
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.06
173 0.08
174 0.08
175 0.12
176 0.14
177 0.16
178 0.18
179 0.27
180 0.36
181 0.42
182 0.51
183 0.57
184 0.64
185 0.74