Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JYS6

Protein Details
Accession A0A1G4JYS6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
80-104IKQVENWLSNRRRKLKRNPIDSSLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
IPR008422  Homeobox_KN_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05920  Homeobox_KN  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MTLDGDKKMILKDIMVAADGIAKKLLVENSGDFFEDIGKPKRFMKCVIFTLEEWFHCHSTYPYPTKTQARTLSEKTGLTIKQVENWLSNRRRKLKRNPIDSSLENILE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.11
5 0.15
6 0.15
7 0.12
8 0.1
9 0.09
10 0.09
11 0.12
12 0.13
13 0.09
14 0.11
15 0.12
16 0.13
17 0.14
18 0.15
19 0.12
20 0.11
21 0.12
22 0.12
23 0.15
24 0.2
25 0.21
26 0.22
27 0.27
28 0.32
29 0.32
30 0.34
31 0.37
32 0.35
33 0.37
34 0.39
35 0.36
36 0.32
37 0.34
38 0.31
39 0.25
40 0.21
41 0.2
42 0.17
43 0.15
44 0.15
45 0.12
46 0.15
47 0.2
48 0.22
49 0.23
50 0.25
51 0.3
52 0.36
53 0.37
54 0.4
55 0.41
56 0.43
57 0.47
58 0.47
59 0.48
60 0.45
61 0.42
62 0.36
63 0.34
64 0.28
65 0.25
66 0.26
67 0.21
68 0.23
69 0.26
70 0.27
71 0.26
72 0.3
73 0.37
74 0.41
75 0.48
76 0.53
77 0.6
78 0.68
79 0.74
80 0.81
81 0.83
82 0.85
83 0.88
84 0.85
85 0.82
86 0.79
87 0.72
88 0.67