Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J405

Protein Details
Accession A0A1G4J405    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSAPRETRKKTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-23TRKKTTRRKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSAPRETRKKTTRRKKDPNAPKRALSAYMFFANENRDIVRAENPGVTFGQVGRILGEKWKALTDDEKVPYESKAEADKKRYESEKELYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.94
4 0.95
5 0.95
6 0.94
7 0.87
8 0.79
9 0.72
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.09
35 0.08
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.12
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.15
50 0.16
51 0.22
52 0.24
53 0.25
54 0.26
55 0.26
56 0.25
57 0.24
58 0.21
59 0.16
60 0.22
61 0.28
62 0.33
63 0.38
64 0.44
65 0.47
66 0.54
67 0.56
68 0.54
69 0.53
70 0.52
71 0.54
72 0.5
73 0.51