Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4IYW7

Protein Details
Accession A0A1G4IYW7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
180-208SKPLHKRLSNCKTSKKLLKRALRRKSGFWHydrophilic
NLS Segment(s)
PositionSequence
194-204KKLLKRALRRK
Subcellular Location(s) nucl 16, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MDQSFPLETHGHSWLQEEEEEEEEVMLFPSYPKRFRASDSAETAGSEDGSSDQCSSGSAPDIESLLDKDDSVTTNADFWREVPVSSEFAGDEPAAVVDPGSACDAELATVSPLASPQEPRLEDFIQDVEPSLSAGPSSYHLQSDYACQSDFQIKRLCFRDADGKLALTDASRSSSLHHISKPLHKRLSNCKTSKKLLKRALRRKSGFWEMASPAFAVAEFMLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.19
5 0.18
6 0.18
7 0.19
8 0.16
9 0.14
10 0.12
11 0.12
12 0.1
13 0.08
14 0.06
15 0.07
16 0.15
17 0.2
18 0.23
19 0.25
20 0.29
21 0.31
22 0.35
23 0.44
24 0.43
25 0.46
26 0.48
27 0.48
28 0.43
29 0.41
30 0.38
31 0.29
32 0.21
33 0.13
34 0.08
35 0.07
36 0.08
37 0.09
38 0.09
39 0.09
40 0.08
41 0.09
42 0.1
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.11
60 0.09
61 0.11
62 0.12
63 0.12
64 0.11
65 0.1
66 0.14
67 0.14
68 0.14
69 0.14
70 0.16
71 0.16
72 0.17
73 0.17
74 0.11
75 0.11
76 0.12
77 0.09
78 0.07
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.06
103 0.08
104 0.12
105 0.13
106 0.14
107 0.18
108 0.18
109 0.18
110 0.18
111 0.17
112 0.12
113 0.12
114 0.11
115 0.07
116 0.07
117 0.07
118 0.06
119 0.05
120 0.04
121 0.04
122 0.04
123 0.07
124 0.09
125 0.09
126 0.1
127 0.11
128 0.11
129 0.12
130 0.15
131 0.15
132 0.14
133 0.13
134 0.13
135 0.14
136 0.22
137 0.22
138 0.22
139 0.27
140 0.26
141 0.33
142 0.36
143 0.37
144 0.29
145 0.3
146 0.37
147 0.31
148 0.34
149 0.29
150 0.26
151 0.24
152 0.24
153 0.21
154 0.12
155 0.12
156 0.08
157 0.1
158 0.1
159 0.1
160 0.13
161 0.18
162 0.23
163 0.26
164 0.26
165 0.29
166 0.33
167 0.43
168 0.49
169 0.52
170 0.56
171 0.55
172 0.6
173 0.66
174 0.72
175 0.73
176 0.71
177 0.72
178 0.71
179 0.77
180 0.81
181 0.8
182 0.8
183 0.8
184 0.83
185 0.84
186 0.88
187 0.89
188 0.89
189 0.83
190 0.79
191 0.78
192 0.77
193 0.7
194 0.62
195 0.57
196 0.5
197 0.48
198 0.43
199 0.34
200 0.24
201 0.2
202 0.17
203 0.12