Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JB23

Protein Details
Accession A0A1G4JB23   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
80-101VKKANKGAKYRQYVNRKDKKLIHydrophilic
NLS Segment(s)
PositionSequence
66-98NKKVQPKNSGGKRVVKKANKGAKYRQYVNRKDK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSQQLPSQELNKAKPAHSNSVPDLKGPASAVLQPATNKVEAPSNQKASQDIADLMGFSGFESTKNKKVQPKNSGGKRVVKKANKGAKYRQYVNRKDKKLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.45
4 0.46
5 0.45
6 0.47
7 0.44
8 0.49
9 0.48
10 0.4
11 0.37
12 0.29
13 0.26
14 0.21
15 0.18
16 0.11
17 0.12
18 0.13
19 0.12
20 0.13
21 0.12
22 0.14
23 0.14
24 0.13
25 0.12
26 0.12
27 0.16
28 0.17
29 0.24
30 0.27
31 0.3
32 0.31
33 0.31
34 0.31
35 0.27
36 0.26
37 0.2
38 0.14
39 0.1
40 0.09
41 0.08
42 0.08
43 0.06
44 0.05
45 0.04
46 0.05
47 0.04
48 0.05
49 0.1
50 0.14
51 0.21
52 0.25
53 0.3
54 0.38
55 0.48
56 0.56
57 0.61
58 0.68
59 0.71
60 0.76
61 0.79
62 0.75
63 0.76
64 0.72
65 0.72
66 0.72
67 0.68
68 0.68
69 0.7
70 0.75
71 0.73
72 0.74
73 0.75
74 0.75
75 0.76
76 0.76
77 0.76
78 0.77
79 0.79
80 0.84
81 0.84
82 0.8