Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4IMY9

Protein Details
Accession A0A1G4IMY9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-130EPLLNTHKQSKRRSKARDGFISLHydrophilic
399-423IDIPQLETKTKKRKTRNTDDAADAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036322  WD40_repeat_dom_sf  
IPR037379  WDR74/Nsa1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042273  P:ribosomal large subunit biogenesis  
CDD cd22858  Nsa1  
Amino Acid Sequences MRFLVACDDGGSIKEVICNRQTNTSVQTALQPFHVGTHLAESLDHRVEIMKSISEDRLLVARANGSVQLIKRSQLPRDSDGKNPDMEPVFTVSDLEVISSIQGLLDDEPLLNTHKQSKRRSKARDGFISLHVVPGKPDRVLCASRSGLIHVLALENDSIHRMLTHTVKAPLEFVQIYDNNAVEGKAKPQTSITIGFGGEENLVKLAKLSSDFENLDVFWQAKNVSNDRLDLKVPIWPMELIFLNSLPSAEEEGENYQFLTISHLGHFRRYQTARGRKPMSSLPLLPKNEIASQIKIINRSLTSSGNVIAANFEELKFLVTDSKKNIILFDTSGNVIGKYGNGDITGFASFVDVIEQRFVLQGGFDRYARIFDAESRNVLCKCYVGAKVSSIVLLDDKEIDIPQLETKTKKRKTRNTDDAADAEEDEELWNSLEKSSKKNKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.22
4 0.28
5 0.32
6 0.32
7 0.39
8 0.41
9 0.41
10 0.44
11 0.42
12 0.37
13 0.33
14 0.38
15 0.33
16 0.32
17 0.29
18 0.26
19 0.22
20 0.22
21 0.22
22 0.16
23 0.13
24 0.16
25 0.16
26 0.15
27 0.16
28 0.16
29 0.2
30 0.2
31 0.2
32 0.16
33 0.17
34 0.17
35 0.2
36 0.19
37 0.16
38 0.16
39 0.2
40 0.21
41 0.2
42 0.19
43 0.17
44 0.19
45 0.18
46 0.17
47 0.15
48 0.15
49 0.14
50 0.15
51 0.14
52 0.13
53 0.15
54 0.16
55 0.21
56 0.2
57 0.21
58 0.28
59 0.32
60 0.36
61 0.39
62 0.44
63 0.43
64 0.5
65 0.52
66 0.51
67 0.54
68 0.51
69 0.46
70 0.4
71 0.4
72 0.34
73 0.31
74 0.25
75 0.22
76 0.2
77 0.18
78 0.18
79 0.13
80 0.12
81 0.11
82 0.1
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.11
98 0.11
99 0.12
100 0.21
101 0.27
102 0.35
103 0.46
104 0.56
105 0.63
106 0.73
107 0.8
108 0.82
109 0.84
110 0.85
111 0.83
112 0.78
113 0.71
114 0.63
115 0.6
116 0.48
117 0.42
118 0.34
119 0.26
120 0.21
121 0.22
122 0.21
123 0.17
124 0.17
125 0.17
126 0.21
127 0.23
128 0.23
129 0.25
130 0.23
131 0.25
132 0.25
133 0.24
134 0.2
135 0.18
136 0.17
137 0.11
138 0.11
139 0.09
140 0.09
141 0.07
142 0.06
143 0.05
144 0.06
145 0.06
146 0.05
147 0.06
148 0.06
149 0.09
150 0.11
151 0.14
152 0.15
153 0.19
154 0.19
155 0.19
156 0.2
157 0.18
158 0.18
159 0.15
160 0.13
161 0.14
162 0.14
163 0.15
164 0.15
165 0.14
166 0.12
167 0.12
168 0.12
169 0.09
170 0.09
171 0.1
172 0.14
173 0.14
174 0.14
175 0.15
176 0.16
177 0.17
178 0.19
179 0.18
180 0.15
181 0.14
182 0.14
183 0.13
184 0.12
185 0.1
186 0.07
187 0.06
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.08
196 0.09
197 0.13
198 0.13
199 0.13
200 0.14
201 0.13
202 0.12
203 0.11
204 0.1
205 0.06
206 0.07
207 0.07
208 0.11
209 0.14
210 0.15
211 0.17
212 0.18
213 0.19
214 0.2
215 0.21
216 0.17
217 0.15
218 0.14
219 0.14
220 0.13
221 0.13
222 0.12
223 0.1
224 0.1
225 0.11
226 0.11
227 0.09
228 0.08
229 0.08
230 0.07
231 0.07
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.07
239 0.09
240 0.1
241 0.09
242 0.09
243 0.08
244 0.07
245 0.07
246 0.1
247 0.09
248 0.1
249 0.11
250 0.16
251 0.16
252 0.2
253 0.21
254 0.19
255 0.26
256 0.27
257 0.33
258 0.39
259 0.49
260 0.52
261 0.6
262 0.62
263 0.54
264 0.56
265 0.54
266 0.48
267 0.42
268 0.39
269 0.37
270 0.42
271 0.42
272 0.39
273 0.36
274 0.33
275 0.31
276 0.31
277 0.27
278 0.21
279 0.21
280 0.25
281 0.25
282 0.25
283 0.24
284 0.22
285 0.2
286 0.21
287 0.21
288 0.18
289 0.17
290 0.16
291 0.16
292 0.15
293 0.14
294 0.12
295 0.1
296 0.09
297 0.09
298 0.09
299 0.08
300 0.07
301 0.07
302 0.08
303 0.08
304 0.08
305 0.13
306 0.14
307 0.18
308 0.21
309 0.26
310 0.27
311 0.28
312 0.28
313 0.23
314 0.23
315 0.21
316 0.19
317 0.16
318 0.14
319 0.16
320 0.15
321 0.13
322 0.12
323 0.11
324 0.09
325 0.09
326 0.1
327 0.08
328 0.08
329 0.08
330 0.08
331 0.1
332 0.1
333 0.08
334 0.07
335 0.07
336 0.07
337 0.06
338 0.09
339 0.08
340 0.08
341 0.09
342 0.09
343 0.09
344 0.1
345 0.1
346 0.08
347 0.08
348 0.1
349 0.14
350 0.17
351 0.17
352 0.18
353 0.18
354 0.2
355 0.2
356 0.18
357 0.14
358 0.19
359 0.26
360 0.27
361 0.29
362 0.29
363 0.33
364 0.32
365 0.33
366 0.27
367 0.2
368 0.19
369 0.22
370 0.24
371 0.23
372 0.24
373 0.25
374 0.26
375 0.26
376 0.24
377 0.19
378 0.16
379 0.14
380 0.12
381 0.11
382 0.1
383 0.1
384 0.11
385 0.11
386 0.11
387 0.1
388 0.11
389 0.14
390 0.18
391 0.22
392 0.27
393 0.36
394 0.47
395 0.55
396 0.63
397 0.7
398 0.76
399 0.83
400 0.88
401 0.9
402 0.87
403 0.85
404 0.8
405 0.71
406 0.64
407 0.54
408 0.43
409 0.32
410 0.23
411 0.17
412 0.13
413 0.11
414 0.09
415 0.08
416 0.1
417 0.1
418 0.12
419 0.19
420 0.21
421 0.29
422 0.39