Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JUL7

Protein Details
Accession A0A1G4JUL7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWKMSRPQKQRQRRRLQDVDAVHydrophilic
106-131AKGYRKGTHKLPKWTKISQRRNPDFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 12.333, cyto_nucl 2.833, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKASSTLLGGLLWKIPWKMSRPQKQRQRRRLQDVDAVIKNLNLGLHATRSMAKGVSFEAAMNSTKLLKPGVKGLRLLNKNSLFPSEKQMSYKDKYTYFNKQAKGYRKGTHKLPKWTKISQRRNPDFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.12
5 0.11
6 0.14
7 0.18
8 0.22
9 0.31
10 0.4
11 0.51
12 0.57
13 0.67
14 0.75
15 0.82
16 0.89
17 0.9
18 0.91
19 0.9
20 0.91
21 0.89
22 0.83
23 0.79
24 0.73
25 0.69
26 0.59
27 0.5
28 0.4
29 0.32
30 0.27
31 0.2
32 0.14
33 0.07
34 0.07
35 0.06
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.18
61 0.22
62 0.23
63 0.24
64 0.27
65 0.35
66 0.37
67 0.38
68 0.38
69 0.35
70 0.35
71 0.34
72 0.34
73 0.29
74 0.27
75 0.32
76 0.29
77 0.28
78 0.29
79 0.33
80 0.35
81 0.35
82 0.4
83 0.37
84 0.36
85 0.4
86 0.44
87 0.5
88 0.53
89 0.56
90 0.55
91 0.58
92 0.62
93 0.66
94 0.68
95 0.64
96 0.62
97 0.64
98 0.66
99 0.69
100 0.71
101 0.7
102 0.73
103 0.77
104 0.78
105 0.77
106 0.8
107 0.81
108 0.82
109 0.84
110 0.83
111 0.84