Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JST0

Protein Details
Accession A0A1G4JST0    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
190-211AEPTKVKTLKSKQLKSKQYLDFHydrophilic
218-245SQSTAKPKKFDNKGPRRGGKPKASQNAGHydrophilic
NLS Segment(s)
PositionSequence
46-93SKANKNRPKPTGNEAAYKDKTGGRKNNKSKDAPAETSGAKRASHAARR
223-240KPKKFDNKGPRRGGKPKA
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
PF09598  Stm1_N  
Amino Acid Sequences MSNPFDLLGNDVEDATVVAPQPPKEIVKKTTSSKKSDVPPPSADPSKANKNRPKPTGNEAAYKDKTGGRKNNKSKDAPAETSGAKRASHAARRSTDRQSRTGKVDTDKRVRQGWGDNKNEVSEEAAAEVDAQAEIEADKAEEEAPVSNKKSLQDYLDEVNKNEFNKTPARKTVDQLDDAELLVKKEEVYAEPTKVKTLKSKQLKSKQYLDFNVSFADSQSTAKPKKFDNKGPRRGGKPKASQNAGEEKPAVNAKNFPSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.1
6 0.13
7 0.14
8 0.16
9 0.19
10 0.24
11 0.29
12 0.35
13 0.37
14 0.42
15 0.47
16 0.53
17 0.61
18 0.63
19 0.64
20 0.62
21 0.64
22 0.65
23 0.68
24 0.66
25 0.61
26 0.59
27 0.58
28 0.6
29 0.56
30 0.5
31 0.46
32 0.46
33 0.51
34 0.54
35 0.58
36 0.61
37 0.67
38 0.75
39 0.77
40 0.76
41 0.7
42 0.7
43 0.7
44 0.64
45 0.61
46 0.56
47 0.58
48 0.53
49 0.49
50 0.43
51 0.37
52 0.4
53 0.41
54 0.47
55 0.48
56 0.58
57 0.67
58 0.75
59 0.79
60 0.76
61 0.73
62 0.73
63 0.69
64 0.61
65 0.53
66 0.47
67 0.41
68 0.38
69 0.36
70 0.28
71 0.21
72 0.19
73 0.23
74 0.25
75 0.32
76 0.35
77 0.38
78 0.41
79 0.47
80 0.51
81 0.55
82 0.56
83 0.52
84 0.54
85 0.54
86 0.53
87 0.52
88 0.51
89 0.45
90 0.44
91 0.48
92 0.48
93 0.51
94 0.5
95 0.48
96 0.47
97 0.44
98 0.41
99 0.41
100 0.42
101 0.43
102 0.43
103 0.42
104 0.39
105 0.39
106 0.37
107 0.28
108 0.2
109 0.12
110 0.08
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.04
117 0.03
118 0.03
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.04
130 0.05
131 0.07
132 0.11
133 0.12
134 0.13
135 0.15
136 0.16
137 0.19
138 0.19
139 0.19
140 0.18
141 0.19
142 0.21
143 0.26
144 0.25
145 0.23
146 0.25
147 0.25
148 0.23
149 0.22
150 0.2
151 0.17
152 0.25
153 0.29
154 0.31
155 0.36
156 0.42
157 0.43
158 0.44
159 0.51
160 0.46
161 0.44
162 0.4
163 0.35
164 0.29
165 0.27
166 0.27
167 0.18
168 0.14
169 0.12
170 0.1
171 0.08
172 0.08
173 0.09
174 0.08
175 0.14
176 0.17
177 0.2
178 0.23
179 0.23
180 0.27
181 0.28
182 0.29
183 0.32
184 0.37
185 0.44
186 0.52
187 0.6
188 0.67
189 0.75
190 0.82
191 0.79
192 0.8
193 0.78
194 0.76
195 0.71
196 0.67
197 0.58
198 0.5
199 0.44
200 0.36
201 0.28
202 0.2
203 0.18
204 0.13
205 0.13
206 0.16
207 0.24
208 0.27
209 0.31
210 0.33
211 0.38
212 0.47
213 0.55
214 0.61
215 0.64
216 0.71
217 0.78
218 0.85
219 0.86
220 0.85
221 0.85
222 0.85
223 0.83
224 0.82
225 0.82
226 0.82
227 0.78
228 0.73
229 0.7
230 0.7
231 0.61
232 0.55
233 0.46
234 0.37
235 0.37
236 0.38
237 0.34
238 0.27
239 0.31
240 0.3