Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4K494

Protein Details
Accession A0A1G4K494   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-218AQPTKQKETDEPKTKKKRSNQPHydrophilic
NLS Segment(s)
PositionSequence
211-213KKK
Subcellular Location(s) nucl 14, cyto_nucl 13.666, cyto 10, mito_nucl 8.832, cyto_mito 6.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR036653  CinA-like_C  
IPR008136  CinA_C  
Pfam View protein in Pfam  
PF02464  CinA  
Amino Acid Sequences MTAEFPPSEATRVVQRISEILVSRNETIAVSEAACGGLLSSYLVSVPGASQWFHGGTMVYSLKSRLKLSGWSEQDIHDYTGPSVDVALRLARNLKFELGASYTLSETGYASRSPNLTSSNREQNVGVVCYGVSGPHEDISATHDTGSEDRCYNMQQFAIHGLKFLLEQLEKTHAERQTKEEVGPATDQKSLVSPSGAQPTKQKETDEPKTKKKRSNQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.24
5 0.27
6 0.2
7 0.2
8 0.23
9 0.25
10 0.25
11 0.24
12 0.22
13 0.18
14 0.18
15 0.16
16 0.13
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.07
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.08
36 0.08
37 0.08
38 0.1
39 0.11
40 0.11
41 0.11
42 0.09
43 0.08
44 0.12
45 0.12
46 0.11
47 0.11
48 0.13
49 0.16
50 0.19
51 0.19
52 0.17
53 0.18
54 0.24
55 0.28
56 0.34
57 0.34
58 0.33
59 0.33
60 0.32
61 0.33
62 0.28
63 0.25
64 0.17
65 0.15
66 0.13
67 0.13
68 0.12
69 0.09
70 0.08
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.11
78 0.12
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.14
85 0.12
86 0.11
87 0.09
88 0.09
89 0.09
90 0.09
91 0.08
92 0.07
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.11
102 0.14
103 0.15
104 0.19
105 0.23
106 0.31
107 0.31
108 0.31
109 0.3
110 0.28
111 0.28
112 0.24
113 0.19
114 0.1
115 0.09
116 0.09
117 0.09
118 0.06
119 0.05
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.11
127 0.13
128 0.11
129 0.11
130 0.11
131 0.12
132 0.14
133 0.16
134 0.14
135 0.12
136 0.12
137 0.13
138 0.15
139 0.16
140 0.16
141 0.15
142 0.13
143 0.13
144 0.19
145 0.21
146 0.19
147 0.17
148 0.16
149 0.15
150 0.14
151 0.14
152 0.11
153 0.09
154 0.1
155 0.12
156 0.17
157 0.18
158 0.2
159 0.26
160 0.27
161 0.32
162 0.34
163 0.37
164 0.39
165 0.4
166 0.38
167 0.36
168 0.33
169 0.3
170 0.32
171 0.3
172 0.24
173 0.24
174 0.24
175 0.2
176 0.21
177 0.21
178 0.18
179 0.17
180 0.16
181 0.18
182 0.28
183 0.29
184 0.28
185 0.34
186 0.41
187 0.47
188 0.48
189 0.47
190 0.46
191 0.55
192 0.64
193 0.68
194 0.68
195 0.71
196 0.8
197 0.85
198 0.85