Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4K3Z8

Protein Details
Accession A0A1G4K3Z8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
201-227DSGFKPFVSRKARRKQKHQPQESEIDYHydrophilic
NLS Segment(s)
PositionSequence
211-215KARRK
Subcellular Location(s) nucl 11.5, cyto_nucl 7, plas 6, mito 3, pero 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MTTRASQKDSNDDFKTVGKTSARLGKASFEENLQERRAIIHRSRMFKALSEELDPFLKDITKIRCLAIGSFHEEFAALYQLALLLELLDLINPGGASFKVSIYDPVFTDADRKFIGNMGSDWTIDEKCPWDPENSSNVLFFLPHAPLDLTQNILISEKPKFFLANHIAKHVDRYTRAQLALKYPVLAKLNHVLASSDPHPDSGFKPFVSRKARRKQKHQPQESEIDYDKIETYFQEVQVITDFSGGRSLMDQPWINSFSDLALQLIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.36
4 0.35
5 0.29
6 0.28
7 0.32
8 0.39
9 0.37
10 0.34
11 0.33
12 0.33
13 0.34
14 0.35
15 0.31
16 0.24
17 0.27
18 0.29
19 0.33
20 0.29
21 0.26
22 0.23
23 0.26
24 0.29
25 0.31
26 0.31
27 0.37
28 0.42
29 0.47
30 0.5
31 0.5
32 0.47
33 0.42
34 0.44
35 0.39
36 0.35
37 0.31
38 0.3
39 0.27
40 0.28
41 0.25
42 0.19
43 0.15
44 0.13
45 0.12
46 0.17
47 0.2
48 0.24
49 0.25
50 0.25
51 0.27
52 0.27
53 0.27
54 0.26
55 0.23
56 0.24
57 0.24
58 0.23
59 0.2
60 0.19
61 0.18
62 0.14
63 0.13
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.05
84 0.06
85 0.06
86 0.07
87 0.08
88 0.11
89 0.11
90 0.12
91 0.11
92 0.13
93 0.13
94 0.12
95 0.17
96 0.14
97 0.16
98 0.15
99 0.15
100 0.12
101 0.14
102 0.15
103 0.11
104 0.11
105 0.11
106 0.12
107 0.11
108 0.11
109 0.11
110 0.11
111 0.09
112 0.1
113 0.09
114 0.09
115 0.11
116 0.12
117 0.12
118 0.13
119 0.16
120 0.19
121 0.2
122 0.2
123 0.18
124 0.17
125 0.15
126 0.13
127 0.11
128 0.09
129 0.07
130 0.06
131 0.07
132 0.07
133 0.07
134 0.1
135 0.1
136 0.09
137 0.09
138 0.09
139 0.09
140 0.09
141 0.09
142 0.08
143 0.11
144 0.1
145 0.11
146 0.11
147 0.12
148 0.12
149 0.2
150 0.26
151 0.3
152 0.3
153 0.31
154 0.33
155 0.32
156 0.35
157 0.3
158 0.26
159 0.22
160 0.26
161 0.29
162 0.3
163 0.32
164 0.31
165 0.3
166 0.3
167 0.33
168 0.28
169 0.24
170 0.21
171 0.25
172 0.24
173 0.22
174 0.2
175 0.2
176 0.22
177 0.22
178 0.22
179 0.18
180 0.16
181 0.21
182 0.19
183 0.19
184 0.17
185 0.16
186 0.17
187 0.18
188 0.19
189 0.21
190 0.22
191 0.19
192 0.25
193 0.27
194 0.35
195 0.44
196 0.51
197 0.55
198 0.63
199 0.74
200 0.77
201 0.85
202 0.87
203 0.89
204 0.91
205 0.91
206 0.89
207 0.84
208 0.83
209 0.75
210 0.69
211 0.6
212 0.5
213 0.4
214 0.32
215 0.27
216 0.19
217 0.17
218 0.11
219 0.15
220 0.17
221 0.17
222 0.2
223 0.19
224 0.2
225 0.22
226 0.22
227 0.17
228 0.16
229 0.16
230 0.12
231 0.15
232 0.14
233 0.12
234 0.13
235 0.16
236 0.14
237 0.21
238 0.22
239 0.21
240 0.26
241 0.28
242 0.27
243 0.25
244 0.23
245 0.18
246 0.19
247 0.18