Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JSR7

Protein Details
Accession A0A1G4JSR7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
187-210KKVILCKKCKARFSGPRRFTNMKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013895  Rsc14  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08586  Rsc14  
Amino Acid Sequences MAQQSLGYYDTISGLSALECSHKVHLSVEQLQQLCTLDKKARKIQDGVDDNGDENERRIRKRAPVHGYLSKIDATIKLDLSNELQHTLLGGHVPRSQLEALSSTDFANYFHKMVDFEKATQTFDMFAHQATMVATAVPTPTPPPSITPTTTPLTRTEFTETAEAVRRSRPQLNSNNSSSGSSAGGVKKVILCKKCKARFSGPRRFTNMKKHMCMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.09
6 0.1
7 0.12
8 0.15
9 0.16
10 0.17
11 0.18
12 0.22
13 0.26
14 0.31
15 0.33
16 0.35
17 0.35
18 0.34
19 0.34
20 0.3
21 0.26
22 0.21
23 0.22
24 0.23
25 0.28
26 0.35
27 0.42
28 0.47
29 0.51
30 0.52
31 0.53
32 0.56
33 0.56
34 0.51
35 0.46
36 0.39
37 0.35
38 0.33
39 0.29
40 0.19
41 0.15
42 0.2
43 0.21
44 0.23
45 0.27
46 0.3
47 0.38
48 0.46
49 0.55
50 0.54
51 0.57
52 0.62
53 0.62
54 0.61
55 0.53
56 0.46
57 0.37
58 0.3
59 0.24
60 0.18
61 0.15
62 0.14
63 0.13
64 0.12
65 0.12
66 0.13
67 0.14
68 0.15
69 0.13
70 0.12
71 0.11
72 0.1
73 0.1
74 0.09
75 0.08
76 0.06
77 0.06
78 0.07
79 0.09
80 0.1
81 0.09
82 0.12
83 0.12
84 0.1
85 0.11
86 0.11
87 0.1
88 0.11
89 0.12
90 0.09
91 0.09
92 0.09
93 0.1
94 0.1
95 0.1
96 0.09
97 0.08
98 0.09
99 0.1
100 0.1
101 0.14
102 0.13
103 0.13
104 0.17
105 0.17
106 0.18
107 0.17
108 0.16
109 0.13
110 0.12
111 0.13
112 0.09
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.08
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.07
128 0.09
129 0.1
130 0.12
131 0.17
132 0.21
133 0.22
134 0.24
135 0.27
136 0.28
137 0.29
138 0.27
139 0.26
140 0.27
141 0.26
142 0.26
143 0.28
144 0.26
145 0.26
146 0.27
147 0.24
148 0.21
149 0.27
150 0.26
151 0.21
152 0.24
153 0.27
154 0.3
155 0.37
156 0.4
157 0.42
158 0.5
159 0.58
160 0.6
161 0.59
162 0.58
163 0.52
164 0.47
165 0.39
166 0.31
167 0.22
168 0.17
169 0.18
170 0.16
171 0.16
172 0.16
173 0.16
174 0.19
175 0.25
176 0.32
177 0.34
178 0.38
179 0.46
180 0.57
181 0.64
182 0.67
183 0.67
184 0.71
185 0.75
186 0.8
187 0.82
188 0.79
189 0.8
190 0.82
191 0.81
192 0.78
193 0.78
194 0.78
195 0.76
196 0.76