Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4K1Z4

Protein Details
Accession A0A1G4K1Z4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-28KIVKKHTKKFKRHHSDRYHR
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIAEPTIGYGSNKKTKFMSPSGHKTFLVCNAKDLDLLTMHTRTYAAEIAHNVSSKNRAALLAKAKALGVKVTNPNGRLGLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.56
24 0.52
25 0.49
26 0.46
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.5
34 0.47
35 0.46
36 0.42
37 0.4
38 0.41
39 0.41
40 0.38
41 0.37
42 0.34
43 0.25
44 0.2
45 0.15
46 0.15
47 0.21
48 0.22
49 0.21
50 0.22
51 0.25
52 0.29
53 0.31
54 0.34
55 0.34
56 0.43
57 0.47
58 0.48
59 0.45
60 0.41
61 0.38
62 0.39
63 0.39
64 0.29
65 0.26
66 0.25
67 0.26
68 0.25
69 0.24
70 0.16
71 0.1
72 0.12
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.09
79 0.11
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.16
88 0.15
89 0.19
90 0.18
91 0.18
92 0.16
93 0.16
94 0.17
95 0.23
96 0.3
97 0.3
98 0.3
99 0.29
100 0.29
101 0.28
102 0.27
103 0.24
104 0.19
105 0.21
106 0.27
107 0.34
108 0.39
109 0.38
110 0.4
111 0.38