Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J6W5

Protein Details
Accession A0A1G4J6W5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-110FDAYRECKKQWLKARRNNRSQWEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13.333, cyto 9, cyto_pero 5.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSDSHGKPVENADPQLQINKEKVDYAPKGAGAKNFKFYPDNPESSFNKFRFAAKDASQFYDPCQESSKMSMKCLETNNYDKSMCQEYFDAYRECKKQWLKARRNNRSQWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.32
4 0.28
5 0.27
6 0.27
7 0.25
8 0.24
9 0.25
10 0.28
11 0.28
12 0.29
13 0.28
14 0.27
15 0.29
16 0.29
17 0.33
18 0.32
19 0.32
20 0.33
21 0.32
22 0.32
23 0.32
24 0.31
25 0.34
26 0.32
27 0.34
28 0.31
29 0.36
30 0.36
31 0.4
32 0.46
33 0.37
34 0.36
35 0.33
36 0.33
37 0.3
38 0.31
39 0.28
40 0.24
41 0.3
42 0.28
43 0.29
44 0.29
45 0.25
46 0.24
47 0.28
48 0.26
49 0.2
50 0.22
51 0.2
52 0.2
53 0.25
54 0.31
55 0.24
56 0.25
57 0.28
58 0.26
59 0.3
60 0.33
61 0.32
62 0.29
63 0.34
64 0.36
65 0.35
66 0.33
67 0.29
68 0.29
69 0.31
70 0.26
71 0.23
72 0.21
73 0.21
74 0.24
75 0.28
76 0.26
77 0.23
78 0.3
79 0.31
80 0.32
81 0.38
82 0.4
83 0.46
84 0.55
85 0.63
86 0.67
87 0.74
88 0.84
89 0.86
90 0.9