Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J129

Protein Details
Accession A0A1G4J129    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42NLEPVKDRRRRRSSSIISHVEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007203  ORMDL  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF04061  ORMDL  
Amino Acid Sequences MPAPASPPPLKRLPSGGSPNGNLEPVKDRRRRRSSSIISHVEPETLEEENDQQMLPNMNASWVDQRGAWAVHVVIIMLLKGFFNLLPGITNEWSWTLTNTTYVIGSYVMFHLVKGTPFDFNGGAYDNLTMWEQINDGMLYTPSRKFLISVPIVLFLVSTHYSRYDLQLFLLNFSLTTFVAVVPKLPLTHRLRITIPFLTGPAQIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.52
4 0.5
5 0.49
6 0.5
7 0.45
8 0.43
9 0.34
10 0.29
11 0.3
12 0.33
13 0.41
14 0.46
15 0.54
16 0.63
17 0.72
18 0.77
19 0.77
20 0.8
21 0.79
22 0.81
23 0.81
24 0.77
25 0.68
26 0.65
27 0.57
28 0.46
29 0.36
30 0.27
31 0.2
32 0.14
33 0.13
34 0.1
35 0.12
36 0.12
37 0.12
38 0.1
39 0.08
40 0.1
41 0.11
42 0.1
43 0.1
44 0.09
45 0.1
46 0.1
47 0.11
48 0.13
49 0.12
50 0.12
51 0.11
52 0.12
53 0.13
54 0.13
55 0.12
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.03
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.09
82 0.09
83 0.08
84 0.08
85 0.09
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.09
105 0.11
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.07
114 0.08
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.1
128 0.1
129 0.11
130 0.12
131 0.12
132 0.13
133 0.15
134 0.22
135 0.22
136 0.23
137 0.22
138 0.23
139 0.23
140 0.21
141 0.19
142 0.1
143 0.12
144 0.11
145 0.11
146 0.1
147 0.11
148 0.14
149 0.15
150 0.19
151 0.18
152 0.17
153 0.18
154 0.23
155 0.22
156 0.22
157 0.22
158 0.18
159 0.15
160 0.14
161 0.15
162 0.09
163 0.09
164 0.08
165 0.07
166 0.1
167 0.1
168 0.11
169 0.11
170 0.12
171 0.13
172 0.14
173 0.23
174 0.27
175 0.36
176 0.38
177 0.41
178 0.42
179 0.45
180 0.49
181 0.42
182 0.38
183 0.31
184 0.29
185 0.27