Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4J179

Protein Details
Accession A0A1G4J179    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAQHAVILHydrophilic
NLS Segment(s)
PositionSequence
15-35AAMAGGKKSKKKWSKKSHKDK
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQEKYDRIMKEVPTYRYVSVSVLVDRLKLGGSLARIVLRQLEQDGVIKPVSKHATQAIYARATSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.22
4 0.19
5 0.2
6 0.21
7 0.24
8 0.28
9 0.32
10 0.41
11 0.5
12 0.57
13 0.65
14 0.73
15 0.81
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.89
22 0.86
23 0.81
24 0.71
25 0.6
26 0.51
27 0.44
28 0.38
29 0.29
30 0.2
31 0.15
32 0.13
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.27
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.11
68 0.12
69 0.12
70 0.12
71 0.12
72 0.14
73 0.15
74 0.14
75 0.14
76 0.16
77 0.15
78 0.22
79 0.25
80 0.23
81 0.25
82 0.28
83 0.31
84 0.31
85 0.35
86 0.33
87 0.31