Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EPC6

Protein Details
Accession A0A0C4EPC6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-46QLYTKKALYKRPHKAIPCTKAHydrophilic
78-101FYPTEVQSKPKKPRKAHRAPGLRSHydrophilic
NLS Segment(s)
PositionSequence
86-97KPKKPRKAHRAP
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR041997  KOW_RPL6  
IPR014722  Rib_L2_dom2  
IPR005568  Ribosomal_L6_N  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01159  Ribosomal_L6e  
PF03868  Ribosomal_L6e_N  
CDD cd13156  KOW_RPL6  
Amino Acid Sequences MAVTTKKNFSRNRAIGPHVNRLSKSQLYTKKALYKRPHKAIPCTKAPEVDYAAAKTVKVGGAKNGGERLVPVHKAPRFYPTEVQSKPKKPRKAHRAPGLRSTLTPGTVIIILAGRFRGKRAVFLKQLESGLLMISGPFKLNGVPLRRVNQAYVIATQTKVDISSMKLDAKFNDVYFAKEKKTRCQRAEAKEFFAENGEREKKKCPDSRIADQKTVDKSLIAAIVQTPVLAKYLATPFGLSNGDFPHRMKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.68
4 0.7
5 0.66
6 0.64
7 0.56
8 0.53
9 0.54
10 0.49
11 0.47
12 0.46
13 0.48
14 0.5
15 0.54
16 0.57
17 0.59
18 0.6
19 0.66
20 0.67
21 0.69
22 0.73
23 0.78
24 0.79
25 0.76
26 0.81
27 0.82
28 0.79
29 0.77
30 0.73
31 0.66
32 0.61
33 0.57
34 0.5
35 0.43
36 0.39
37 0.32
38 0.26
39 0.27
40 0.23
41 0.22
42 0.17
43 0.16
44 0.15
45 0.15
46 0.15
47 0.15
48 0.21
49 0.22
50 0.24
51 0.24
52 0.22
53 0.19
54 0.19
55 0.19
56 0.17
57 0.18
58 0.17
59 0.23
60 0.25
61 0.28
62 0.29
63 0.32
64 0.32
65 0.35
66 0.39
67 0.36
68 0.43
69 0.42
70 0.49
71 0.5
72 0.54
73 0.61
74 0.65
75 0.69
76 0.69
77 0.78
78 0.82
79 0.84
80 0.85
81 0.85
82 0.86
83 0.8
84 0.79
85 0.74
86 0.63
87 0.52
88 0.47
89 0.38
90 0.28
91 0.24
92 0.16
93 0.12
94 0.11
95 0.11
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.13
105 0.13
106 0.2
107 0.23
108 0.29
109 0.32
110 0.34
111 0.35
112 0.31
113 0.32
114 0.24
115 0.22
116 0.15
117 0.1
118 0.08
119 0.06
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.07
128 0.12
129 0.15
130 0.2
131 0.23
132 0.26
133 0.29
134 0.3
135 0.28
136 0.26
137 0.25
138 0.21
139 0.2
140 0.18
141 0.16
142 0.15
143 0.15
144 0.12
145 0.1
146 0.09
147 0.08
148 0.07
149 0.08
150 0.11
151 0.13
152 0.16
153 0.17
154 0.18
155 0.18
156 0.21
157 0.21
158 0.18
159 0.21
160 0.19
161 0.21
162 0.25
163 0.27
164 0.26
165 0.3
166 0.32
167 0.37
168 0.48
169 0.54
170 0.53
171 0.61
172 0.66
173 0.71
174 0.8
175 0.73
176 0.67
177 0.6
178 0.57
179 0.46
180 0.4
181 0.32
182 0.22
183 0.28
184 0.3
185 0.29
186 0.31
187 0.39
188 0.42
189 0.51
190 0.57
191 0.55
192 0.58
193 0.64
194 0.73
195 0.76
196 0.75
197 0.71
198 0.66
199 0.66
200 0.6
201 0.54
202 0.44
203 0.33
204 0.27
205 0.24
206 0.23
207 0.16
208 0.13
209 0.1
210 0.12
211 0.11
212 0.11
213 0.09
214 0.08
215 0.09
216 0.08
217 0.08
218 0.11
219 0.15
220 0.17
221 0.17
222 0.18
223 0.17
224 0.21
225 0.22
226 0.17
227 0.17
228 0.19
229 0.22
230 0.23