Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JVQ6

Protein Details
Accession A0A1G4JVQ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68FKEGKKRKVAEKKPLDFLRTBasic
NLS Segment(s)
PositionSequence
49-62FKEGKKRKVAEKKP
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MAKQKSKNSVIKLISTAATGFARQITISRGAPLVTQVRYDPIAKRHVLFKEGKKRKVAEKKPLDFLRTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.24
4 0.18
5 0.15
6 0.12
7 0.11
8 0.09
9 0.09
10 0.08
11 0.09
12 0.09
13 0.12
14 0.12
15 0.13
16 0.13
17 0.13
18 0.12
19 0.14
20 0.15
21 0.12
22 0.12
23 0.11
24 0.13
25 0.14
26 0.16
27 0.16
28 0.17
29 0.22
30 0.22
31 0.23
32 0.27
33 0.28
34 0.31
35 0.35
36 0.41
37 0.47
38 0.55
39 0.6
40 0.6
41 0.62
42 0.68
43 0.73
44 0.73
45 0.73
46 0.74
47 0.75
48 0.79
49 0.8
50 0.73