Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JSS2

Protein Details
Accession A0A1G4JSS2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPQKALKVTKKSKDPRRVTKKQKNLRKAAPLQHydrophilic
NLS Segment(s)
PositionSequence
7-46KVTKKSKDPRRVTKKQKNLRKAAPLQIKSRKKSLAHLKKL
75-86KELEKQKKKDTK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVTKKSKDPRRVTKKQKNLRKAAPLQIKSRKKSLAHLKKLSKASSLTETTEKLISSRVGHLELLKGTRKELEKQKKKDTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.9
11 0.89
12 0.86
13 0.84
14 0.79
15 0.77
16 0.77
17 0.71
18 0.69
19 0.71
20 0.71
21 0.64
22 0.63
23 0.59
24 0.51
25 0.55
26 0.58
27 0.58
28 0.59
29 0.65
30 0.64
31 0.65
32 0.67
33 0.59
34 0.51
35 0.41
36 0.35
37 0.31
38 0.29
39 0.25
40 0.23
41 0.23
42 0.22
43 0.21
44 0.18
45 0.14
46 0.14
47 0.14
48 0.13
49 0.16
50 0.16
51 0.16
52 0.17
53 0.18
54 0.18
55 0.19
56 0.21
57 0.24
58 0.23
59 0.22
60 0.28
61 0.3
62 0.36
63 0.45
64 0.53
65 0.57
66 0.66