Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JV00

Protein Details
Accession A0A1G4JV00    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-96SLMPGKVAKKRKSKNSKLASVIHydrophilic
NLS Segment(s)
PositionSequence
80-89KVAKKRKSKN
120-132PKVGKKKKKNKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSSDRLDSYITSSIALLEANPSSTLVSVKYQSGAKAGKVSFSTSNPNLLANHKYSTSKSKDVSRLLSALGPRGVSLMPGKVAKKRKSKNSKLASVIDVNGMSSLMANVDIPEAIEEAPQPKVGKKKKKNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.09
4 0.08
5 0.08
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.1
12 0.09
13 0.12
14 0.12
15 0.13
16 0.15
17 0.16
18 0.16
19 0.2
20 0.2
21 0.19
22 0.23
23 0.22
24 0.22
25 0.22
26 0.25
27 0.22
28 0.23
29 0.28
30 0.23
31 0.27
32 0.24
33 0.24
34 0.23
35 0.23
36 0.24
37 0.19
38 0.2
39 0.18
40 0.19
41 0.2
42 0.26
43 0.28
44 0.3
45 0.3
46 0.35
47 0.39
48 0.41
49 0.42
50 0.36
51 0.31
52 0.27
53 0.26
54 0.2
55 0.16
56 0.13
57 0.1
58 0.09
59 0.09
60 0.08
61 0.07
62 0.08
63 0.07
64 0.08
65 0.11
66 0.13
67 0.18
68 0.28
69 0.35
70 0.44
71 0.52
72 0.61
73 0.7
74 0.78
75 0.82
76 0.82
77 0.82
78 0.77
79 0.72
80 0.64
81 0.55
82 0.46
83 0.37
84 0.28
85 0.2
86 0.15
87 0.12
88 0.08
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.14
106 0.14
107 0.19
108 0.29
109 0.39
110 0.49
111 0.58
112 0.68