Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JMU3

Protein Details
Accession A0A1G4JMU3   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-119LTKFEASRVTPKQKKKQIAFPQRKFAIKHydrophilic
NLS Segment(s)
PositionSequence
77-116PKDMRAKKTRALRRALTKFEASRVTPKQKKKQIAFPQRKF
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGVKSYVLRTKSKEQLESQLVDLKKELASLKVQKLSRPSLPKIHTVRKDIARVLTIINENQRQAVRELYKGAKYQPKDMRAKKTRALRRALTKFEASRVTPKQKKKQIAFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.57
4 0.57
5 0.53
6 0.46
7 0.45
8 0.39
9 0.34
10 0.31
11 0.23
12 0.18
13 0.19
14 0.17
15 0.13
16 0.19
17 0.25
18 0.29
19 0.34
20 0.35
21 0.36
22 0.4
23 0.43
24 0.43
25 0.44
26 0.43
27 0.44
28 0.46
29 0.52
30 0.53
31 0.58
32 0.56
33 0.53
34 0.56
35 0.52
36 0.52
37 0.45
38 0.4
39 0.32
40 0.27
41 0.23
42 0.19
43 0.15
44 0.14
45 0.15
46 0.15
47 0.14
48 0.15
49 0.15
50 0.14
51 0.14
52 0.18
53 0.16
54 0.16
55 0.19
56 0.2
57 0.23
58 0.23
59 0.26
60 0.28
61 0.28
62 0.36
63 0.4
64 0.45
65 0.52
66 0.58
67 0.64
68 0.66
69 0.7
70 0.67
71 0.7
72 0.71
73 0.69
74 0.69
75 0.65
76 0.68
77 0.7
78 0.69
79 0.63
80 0.6
81 0.54
82 0.51
83 0.49
84 0.41
85 0.42
86 0.45
87 0.51
88 0.53
89 0.62
90 0.69
91 0.73
92 0.81
93 0.8
94 0.82
95 0.83
96 0.86
97 0.87
98 0.85
99 0.86
100 0.82