Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167DHC8

Protein Details
Accession A0A167DHC8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
192-213FDRLGDKKKKPAPVKKAAAPVEHydrophilic
NLS Segment(s)
PositionSequence
198-208KKKKPAPVKKA
Subcellular Location(s) E.R. 6, cyto 5.5, mito 4, plas 4, cyto_nucl 3.5, extr 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG slb:AWJ20_1199  -  
Amino Acid Sequences MKLASILSSFLALGSVAFAAGESATENKEVLKVDVQFPDEYIKDYGVELINDVETPVKIYFTNGMPAEGGLPFVLAAVGGSVFEKENPDKVFTNLTIAKIGPVSIGPGETKLVTHSLKFNLPPKEFNLGFVFYLQHDEEFFSFKLDQKMPLFIADPPISSFDPRLILVQIITGVTVGFIGYFLTKTYVAPVFDRLGDKKKKPAPVKKAAAPVEKDEAASSGYDESWIPEHHLKTRSSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.06
11 0.07
12 0.08
13 0.09
14 0.09
15 0.11
16 0.12
17 0.13
18 0.17
19 0.18
20 0.22
21 0.25
22 0.28
23 0.25
24 0.25
25 0.27
26 0.22
27 0.23
28 0.2
29 0.17
30 0.15
31 0.15
32 0.17
33 0.14
34 0.13
35 0.11
36 0.11
37 0.1
38 0.1
39 0.1
40 0.08
41 0.07
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.13
48 0.13
49 0.19
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.12
56 0.12
57 0.06
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.08
72 0.09
73 0.13
74 0.14
75 0.18
76 0.18
77 0.19
78 0.21
79 0.19
80 0.23
81 0.2
82 0.2
83 0.18
84 0.17
85 0.16
86 0.13
87 0.13
88 0.08
89 0.06
90 0.06
91 0.05
92 0.06
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.09
100 0.09
101 0.1
102 0.12
103 0.13
104 0.15
105 0.17
106 0.23
107 0.26
108 0.27
109 0.28
110 0.28
111 0.33
112 0.31
113 0.31
114 0.27
115 0.21
116 0.2
117 0.19
118 0.17
119 0.11
120 0.13
121 0.11
122 0.09
123 0.08
124 0.09
125 0.09
126 0.11
127 0.11
128 0.1
129 0.11
130 0.13
131 0.18
132 0.18
133 0.22
134 0.2
135 0.22
136 0.2
137 0.2
138 0.19
139 0.15
140 0.19
141 0.16
142 0.15
143 0.14
144 0.17
145 0.16
146 0.16
147 0.16
148 0.12
149 0.13
150 0.13
151 0.13
152 0.11
153 0.11
154 0.1
155 0.1
156 0.09
157 0.07
158 0.06
159 0.05
160 0.04
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.05
170 0.07
171 0.07
172 0.08
173 0.11
174 0.14
175 0.15
176 0.16
177 0.19
178 0.18
179 0.2
180 0.24
181 0.24
182 0.31
183 0.38
184 0.4
185 0.47
186 0.52
187 0.59
188 0.66
189 0.73
190 0.74
191 0.76
192 0.81
193 0.78
194 0.81
195 0.78
196 0.75
197 0.68
198 0.62
199 0.57
200 0.5
201 0.43
202 0.34
203 0.28
204 0.22
205 0.18
206 0.15
207 0.1
208 0.1
209 0.1
210 0.1
211 0.11
212 0.13
213 0.14
214 0.18
215 0.23
216 0.27
217 0.33
218 0.38
219 0.4