Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167CAK4

Protein Details
Accession A0A167CAK4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23NISTSTIQQRRRRPTQNVIEEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038324  Rpb4/RPC9_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
KEGG slb:AWJ20_4244  -  
Amino Acid Sequences MNISTSTIQQRRRRPTQNVIEEEDASQLKLGPEFDIKQITHDGLETPLITLNLSETRLLINAALKQRNKEANGANFDGDLENNDDDEDEDFSSSNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.82
4 0.83
5 0.78
6 0.74
7 0.67
8 0.58
9 0.5
10 0.43
11 0.32
12 0.22
13 0.17
14 0.12
15 0.1
16 0.1
17 0.1
18 0.09
19 0.11
20 0.12
21 0.14
22 0.17
23 0.17
24 0.17
25 0.18
26 0.17
27 0.14
28 0.13
29 0.12
30 0.08
31 0.09
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.08
46 0.07
47 0.07
48 0.11
49 0.17
50 0.23
51 0.24
52 0.25
53 0.31
54 0.36
55 0.36
56 0.38
57 0.39
58 0.4
59 0.45
60 0.44
61 0.39
62 0.33
63 0.32
64 0.27
65 0.2
66 0.15
67 0.12
68 0.11
69 0.11
70 0.11
71 0.1
72 0.11
73 0.12
74 0.12
75 0.09
76 0.1