Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FTM5

Protein Details
Accession A0A167FTM5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
168-195IKESWSPRRARARNDRQRRKRLWIRDAQHydrophilic
NLS Segment(s)
PositionSequence
174-189PRRARARNDRQRRKRL
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Gene Ontology GO:0005840  C:ribosome  
KEGG slb:AWJ20_3327  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MLSKHRVTLGLSGNSFLRSIRNASSKHTNPGREAIPTRFPTLYNPKRSASNNKIQLPIGLVYNPAPAAPSPYETPAAFLPKEDKRTVVVNSEEFPVDKIPALKEPLEKKYNLTEKDLIEIHNLRTSDPNKWTRRALAEKFSCSEFMISVASKPNPEYKKEMDERLETIKESWSPRRARARNDRQRRKRLWIRDAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.22
4 0.18
5 0.14
6 0.17
7 0.22
8 0.28
9 0.28
10 0.34
11 0.44
12 0.45
13 0.52
14 0.55
15 0.53
16 0.49
17 0.53
18 0.48
19 0.44
20 0.45
21 0.4
22 0.42
23 0.41
24 0.42
25 0.37
26 0.36
27 0.37
28 0.44
29 0.48
30 0.48
31 0.5
32 0.48
33 0.53
34 0.57
35 0.6
36 0.57
37 0.58
38 0.58
39 0.58
40 0.59
41 0.54
42 0.49
43 0.41
44 0.34
45 0.25
46 0.16
47 0.13
48 0.11
49 0.12
50 0.11
51 0.08
52 0.08
53 0.06
54 0.1
55 0.1
56 0.12
57 0.12
58 0.14
59 0.17
60 0.16
61 0.17
62 0.15
63 0.18
64 0.15
65 0.14
66 0.18
67 0.2
68 0.25
69 0.23
70 0.23
71 0.21
72 0.24
73 0.25
74 0.24
75 0.22
76 0.18
77 0.19
78 0.19
79 0.17
80 0.14
81 0.14
82 0.1
83 0.09
84 0.08
85 0.08
86 0.08
87 0.1
88 0.12
89 0.13
90 0.17
91 0.21
92 0.26
93 0.28
94 0.28
95 0.28
96 0.34
97 0.39
98 0.36
99 0.36
100 0.34
101 0.31
102 0.34
103 0.33
104 0.26
105 0.23
106 0.22
107 0.19
108 0.19
109 0.18
110 0.16
111 0.22
112 0.23
113 0.24
114 0.3
115 0.38
116 0.39
117 0.43
118 0.45
119 0.43
120 0.49
121 0.52
122 0.49
123 0.49
124 0.5
125 0.49
126 0.48
127 0.45
128 0.38
129 0.3
130 0.26
131 0.17
132 0.13
133 0.12
134 0.11
135 0.11
136 0.15
137 0.15
138 0.16
139 0.17
140 0.25
141 0.26
142 0.3
143 0.35
144 0.35
145 0.43
146 0.47
147 0.52
148 0.48
149 0.48
150 0.47
151 0.47
152 0.44
153 0.35
154 0.31
155 0.29
156 0.29
157 0.31
158 0.36
159 0.39
160 0.42
161 0.49
162 0.6
163 0.62
164 0.68
165 0.74
166 0.77
167 0.8
168 0.87
169 0.9
170 0.9
171 0.94
172 0.92
173 0.91
174 0.9
175 0.9