Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FBI6

Protein Details
Accession A0A167FBI6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKKRASNGRNKKGRGHVTSBasic
88-111SREGRRIRTPPPRVRYNRDGKKINBasic
NLS Segment(s)
PositionSequence
3-15KKRASNGRNKKGR
85-109RVRSREGRRIRTPPPRVRYNRDGKK
Subcellular Location(s) mito 16.5, mito_nucl 10.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG slb:AWJ20_2693  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVTSVRCSNCSRMVPKDKAIKRFTIRNMVESAAIRDISDASVYQEYALPKLYIKIHYCVSCAIHGKIVRVRSREGRRIRTPPPRVRYNRDGKKINPQAAAKAAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.72
4 0.7
5 0.68
6 0.72
7 0.71
8 0.63
9 0.56
10 0.52
11 0.48
12 0.46
13 0.44
14 0.4
15 0.43
16 0.49
17 0.51
18 0.56
19 0.62
20 0.61
21 0.63
22 0.62
23 0.6
24 0.56
25 0.59
26 0.56
27 0.56
28 0.52
29 0.45
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.11
54 0.12
55 0.15
56 0.17
57 0.19
58 0.21
59 0.22
60 0.22
61 0.22
62 0.21
63 0.2
64 0.21
65 0.19
66 0.2
67 0.21
68 0.23
69 0.25
70 0.3
71 0.32
72 0.31
73 0.35
74 0.4
75 0.48
76 0.54
77 0.59
78 0.62
79 0.65
80 0.7
81 0.75
82 0.76
83 0.78
84 0.78
85 0.78
86 0.79
87 0.79
88 0.8
89 0.81
90 0.82
91 0.82
92 0.81
93 0.8
94 0.73
95 0.77
96 0.77
97 0.74
98 0.7
99 0.62
100 0.58